Recombinant Guinea pig 5-hydroxytryptamine receptor 2A (HTR2A)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Properties

The receptor binds serotonin (5-HT) and activates phospholipase C (PLC) via Gαq/11 proteins, increasing intracellular inositol phosphates and calcium . Functional assays show:

  • Ligand specificity: High affinity for hallucinogens (e.g., DOI) and antipsychotics .

  • Signaling pathways: Couples to cAMP modulation in recombinant systems .

  • Key domains: EL2 contains a conserved disulfide bridge (Cys3.25–CysEL2) critical for ligand interaction .

Functional comparison with human HTR2A:

PropertyGuinea Pig HTR2AHuman HTR2A
Tegaserod potencypEC₅₀ = 8.2 (partial agonist)pEC₅₀ = 8.7 (full agonist)
Expression density~0.2 pmol/mg protein Similar to guinea pig

Antibody Development

  • An extracellular-targeting antibody (epitope: residues 40–52) enables immunohistochemistry and Western blotting in guinea pig brain tissues .

  • Validated in dorsal root ganglia and raphe nucleus neurons, with blocking peptide controls confirming specificity .

Pharmacological Studies

  • Used to characterize agonist/antagonist profiles (e.g., tegaserod’s partial efficacy in colon LMMP assays) .

  • Facilitates cross-species comparisons of 5-HT2A receptor evolution .

Technical Considerations

  • Storage: Lyophilized powder stable at -80°C; reconstitution in Tris/PBS with trehalose preserves activity .

  • Species-specific notes: Guinea pig HTR2A shares 95% homology with human 5-HT4(b) receptors, making it a translational model for gastrointestinal motility studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.
Synonyms
HTR2A; 5-hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; Serotonin receptor 2A; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
KLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVG ISMPVPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVAFFIPLTIMVITYFLTIKSLQKEA TLCVSDPGTRAKLSSFSFLPQSSLSSEKLFQRSIHRETGSYAGRRTMQSISNEQKACKVL GIVFFLFVVMWCPFFVTNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNK TYRSAFA
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 2A (HTR2A) is a G-protein coupled receptor that binds to 5-hydroxytryptamine (serotonin). It also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI), and lysergic acid diethylamide (LSD). Ligand binding induces a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins), modulating the activity of downstream effectors. Members of the beta-arrestin family inhibit G protein signaling and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system, affecting the activity of phosphatidylinositol 3-kinase and promoting the release of Ca(2+) ions from intracellular stores. HTR2A influences neural activity, perception, cognition, and mood. It plays a crucial role in regulating behavior, including responses to anxiogenic situations and psychoactive substances. Furthermore, it contributes to intestinal smooth muscle contraction and may be involved in arterial vasoconstriction.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, axon. Cytoplasmic vesicle. Membrane, caveola. Cell junction, synapse, presynapse.
Tissue Specificity
Detected in adult intestine, especially in mucosal epithelium, longitudinal and circular layers of muscularis externa and myenteric plexuses. Highly expressed in Paneth cells, and detected at lower levels in enterocytes (at protein level).

Q&A

What is the molecular structure of the guinea pig 5-HT2A receptor?

The guinea pig 5-HT2A receptor is a G-protein coupled receptor (GPCR) consisting of seven membrane-spanning α-helical segments with an extracellular N-terminus and an intracellular C-terminus. The receptor exhibits structural characteristics typical of the 5-HT2 family, which mediates serotonin signaling through conformational changes that activate associated heterotrimeric G proteins and recruit downstream signaling molecules such as GPCR kinases and β-arrestins . Specifically, the extracellular N-terminus contains amino acid residues 40-52 (SEASNWTIDAENR) that serve as important epitopes for antibody production and binding studies .

How does the guinea pig 5-HT2A receptor compare to human 5-HT2A receptors?

While the search results don't provide specific comparison data between guinea pig and human 5-HT2A receptors, they do indicate that guinea pig models may be more appropriate than rat or mouse models for certain serotonin receptor studies. For instance, in the case of the 5-HT1E receptor (another serotonin receptor subtype), the guinea pig homolog shares 88% nucleic acid and 95% amino acid sequence homology with the human receptor, with highly correlated pharmacological properties (R² = 0.99 for drug affinities) . This suggests that guinea pig serotonin receptors generally maintain high evolutionary conservation with human receptors, making them valuable research models.

What are the key pharmacological properties of guinea pig 5-HT2A receptors?

The pharmacological profile of the 5-HT2A receptor includes interactions with various ligands, including its natural ligands 5-hydroxytryptamine (serotonin) and tryptamine . The receptor demonstrates specific binding patterns with certain compounds. For instance, when comparing compound affinities across serotonin receptor subtypes, compounds 2 and 5 show a potency order of 5-HT2A > 5-HT1A > 5-HT2C . This pharmacological signature is essential for designing selective compounds for experimental studies and potential therapeutic applications targeting this receptor subtype.

How do signaling pathways differ between guinea pig 5-HT2A receptors and other species models?

The binding of 5-HT to 5-HT2A receptors elicits conformational changes that activate associated heterotrimeric G proteins and recruits downstream signaling molecules, including GPCR kinases and β-arrestins . While the search results don't provide specific comparisons of signaling pathways between species, they indicate that the guinea pig model may offer advantages for studying certain serotonin receptor subtypes not expressed in rats or mice. Researchers should consider these species differences when interpreting signaling cascade experiments and pharmacological interventions targeting these receptors.

What techniques are available for visualizing guinea pig 5-HT2A receptor expression?

Immunohistochemical techniques have proven effective for visualizing 5-HT2A receptors in guinea pig brain tissue. Specifically, perfusion-fixed frozen brain sections can be stained with Guinea Pig Anti-5HT2A Receptor (HTR2A) (extracellular) Antibody, followed by secondary antibody detection (e.g., goat anti-guinea pig - Alexa Fluor-594) . This approach reveals 5-HT2A immunoreactivity in neuronal outlines. For validation of antibody specificity, pre-incubation with 5HT2A Receptor (HTR2A) (extracellular) Blocking Peptide can be used to demonstrate suppression of staining . Cell nuclei can be counterstained with DAPI to provide anatomical context.

How can binding affinity be determined for compounds targeting guinea pig 5-HT2A receptors?

Radioligand binding assays are effective for determining binding affinities of compounds to guinea pig 5-HT2A receptors. While the search results don't provide specific protocols for 5-HT2A receptor binding assays in guinea pigs, they describe approaches for other serotonin receptors that can be adapted. For instance, with the 5-HT1E receptor, [³H]5-HT was used as a radioligand with appropriate masking conditions (using specific concentrations of compounds like 5-CT and ritanserin) to block binding to non-target receptors . For 5-HT2A receptors specifically, [¹²⁵I]LSD has been utilized as a radioligand, with spiperone (1 μM) and sulpiride (1 μM) to displace binding from 5-HT2A and D2 binding sites, respectively . Quantification can be performed using computer-aided image analysis densitometry systems like MCID.

What are the recommended protocols for Western blot analysis of guinea pig 5-HT2A receptors?

Western blot analysis can be performed using Guinea Pig Anti-5HT2A Receptor (HTR2A) (extracellular) Antibody at a dilution of 1:200 . The search results demonstrate successful application with rat dorsal root ganglion lysates and mouse brain lysates, suggesting cross-reactivity across species . Specificity can be confirmed using 5HT2A Receptor (HTR2A) (extracellular) Blocking Peptide. While specific buffer compositions and electrophoresis conditions aren't detailed in the search results, standard protein isolation and Western blot protocols for membrane proteins would be applicable, with particular attention to maintaining protein integrity during membrane protein extraction.

What advantages does the guinea pig model offer over rat and mouse models for 5-HT receptor research?

Guinea pig models offer distinct advantages for certain serotonin receptor studies. For example, the 5-HT1E receptor, originally discovered in human brain tissue, is not expressed in rat or mouse brain but is present in guinea pig brain . This makes guinea pigs a more appropriate model for studying these specific receptor subtypes. Similarly, there are differences in 5-HT2A receptor distribution between guinea pig and rat brains, with rats showing high levels of specific binding in the tenia tecta and mammillary nuclei, while guinea pigs display little binding in these regions . These species differences should be considered when selecting appropriate models for specific research questions related to serotonin receptor function and distribution.

How can recombinant guinea pig 5-HT2A receptors be utilized in psychiatric disorder research?

The 5-HT2A receptor has been implicated in various mental disorders . Recombinant guinea pig 5-HT2A receptors can serve as valuable tools for screening potential therapeutic compounds and investigating receptor-mediated signaling mechanisms relevant to psychiatric conditions. By expressing these receptors in cell lines, researchers can conduct high-throughput screening of compound libraries to identify novel ligands with specific pharmacological profiles. Additionally, the guinea pig model may offer advantages over rat or mouse models for studying certain aspects of serotonergic function in psychiatric disorders, given the closer homology to human receptors in some cases.

What role do 5-HT2A receptors play in neurological functions relevant to disease models?

5-HT (serotonin) is involved in diverse physiological and biological processes. In the brain, 5-HT affects sleep, mood, appetite, anxiety, aggression, perception, pain, and cognition . The 5-HT2A receptor mediates many of these effects through G-protein coupled signaling pathways. 5-HT2A receptors have been found in many regions of the human brain, including the cortex, brainstem, olfactory bulb, limbic system, and basal ganglia . This distribution pattern correlates with the receptor's involvement in various neurological functions and pathologies. When developing disease models, researchers should consider the specific distribution and signaling properties of 5-HT2A receptors in relation to the neurological functions being investigated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.