Recombinant Guinea pig 5-hydroxytryptamine receptor 2B (HTR2B)

Shipped with Ice Packs
In Stock

Description

Functional Roles of HTR2B

Guinea pig HTR2B shares structural and functional homology with human HTR2B, which regulates:

  • Cardiovascular Effects: Pulmonary vasoconstriction, cardiac valve fibroblast proliferation, and pathological cardiac hypertrophy .

  • Central Nervous System (CNS): Modulation of raphe serotonin neurons, countering 5-HT1A autoreceptor-induced hypothermia, and influencing impulsivity .

  • Gastrointestinal (GI) Tract: Stomach fundus contraction and smooth muscle regulation .

Key findings: HTR2B antagonists block angiotensin II or β-adrenergic agonist-induced cardiac hypertrophy in mice .

Applications in Research

Recombinant Guinea pig HTR2B is primarily used to study receptor-ligand interactions, signaling pathways, and therapeutic targets.

ApplicationDetails
Binding AssaysTesting agonist/antagonist affinity (e.g., BW723C86, RS127445)
ELISA/Western BlottingDetection of HTR2B expression in tissue lysates or recombinant systems
Functional StudiesAssessing G-protein coupling efficiency and calcium mobilization
Drug DiscoveryScreening for HTR2B-specific antagonists to treat fibrosis or cardiovascular diseases

Key sources: Cusabio , PMC

Research Findings and Limitations

  • Serotonin Regulation: HTR2B directly stimulates raphe serotonin neuron firing, counteracting 5-HT1A receptor-mediated inhibition . Viral overexpression in Pet1-positive neurons increases excitability .

  • Fibrosis and Liver Disease: HTR2B antagonism reduces hepatic stellate cell activation and fibrogenesis in rodent models .

  • Limitations: Low CNS expression in rodents limits direct behavioral studies; most data derive from peripheral models or human/mouse analogs .

Key studies: Electrophysiological recordings in Htr2b knockout mice revealed impaired MDMA-induced locomotor responses .

Comparative Analysis with Other HTR2B Receptors

ReceptorExpressionPrimary FunctionsDisease Relevance
Guinea Pig HTR2BLiver, GI tract, heartFibrosis, cardiac hypertrophy, GI motilityLiver fibrosis, cardiac valvulopathy
Human HTR2BStomach fundus, heart, CNSCardiac valve maintenance, impulsivityDrug-induced valvulopathy, obesity
Mouse HTR2BCNS, liver, vascular tissuesSerotonin release regulation, behavior, fibrosisMDMA effects, SSRI mechanisms

Key sources: GeneCards , PMC

Future Directions

  • Therapeutic Targets: Development of selective HTR2B antagonists for fibrosis and cardiovascular diseases .

  • Structural Insights: Crystallography studies to elucidate ligand-binding mechanisms and biased signaling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them in your order. We will prepare the product according to your requirements.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR2B; 5-hydroxytryptamine receptor 2B; 5-HT-2B; 5-HT2B; Serotonin receptor 2B; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-96
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
CNQSTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYKATKSVKTVRKCS NKIYFRNPMTENSKFFMKHGMRNGINSTMYQSPVRL
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 2B (HTR2B) is a G-protein coupled receptor for 5-hydroxytryptamine (serotonin). It also functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding induces a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins), thereby modulating the activity of downstream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and downstream signaling cascades, promoting the release of Ca(2+) ions from intracellular stores. This receptor plays a crucial role in regulating dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake, and the regulation of extracellular dopamine and 5-hydroxytryptamine levels, ultimately affecting neural activity. HTR2B may also be involved in pain perception. It further contributes to the regulation of behavior, including impulsive behavior. This receptor is essential for normal proliferation of embryonic cardiac myocytes and proper heart development. It protects cardiomyocytes against apoptosis. HTR2B plays a role in the adaptation of pulmonary arteries to chronic hypoxia and participates in vasoconstriction. It is required for normal osteoblast function and proliferation, maintaining normal bone density. Additionally, it is essential for the normal proliferation of the interstitial cells of Cajal in the intestine.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.

Q&A

What is the functional characterization of recombinant guinea pig HTR2B?

The guinea pig HTR2B (5-hydroxytryptamine receptor 2B) is a G-protein coupled receptor in the serotonin receptor family. While specific characterization data for recombinant guinea pig HTR2B is limited in the provided materials, related research demonstrates that similar receptors from this family are commonly characterized through G-protein activation monitoring using agonist-stimulated [35S]-GTPγS binding assays . The receptor plays crucial roles in physiological processes including gastric accommodation and likely in metabolic regulation, as evidenced by related studies in other species .

For functional characterization, researchers typically employ:

  • Recombinant expression systems (stable transfection in cell lines)

  • Radioligand binding assays to determine binding kinetics

  • G-protein activation assays to measure downstream signaling

  • Physiological function assessment in tissue-specific contexts

How does HTR2B signaling differ between guinea pig models and other species?

While direct comparative data between guinea pig and other species' HTR2B receptors is limited in the provided materials, important functional similarities and differences can be inferred:

  • Studies on guinea pig 5-HT1B receptors show similarities with human 5-HT1B receptors in binding properties , suggesting conserved functionality across species for serotonin receptors

  • The guinea pig HTR2B plays a crucial role in gastric accommodation and stress responses , while mouse HTR2B knockout studies highlight its essential role in cardiac development and function

  • In mice, HTR2B signaling in visceral adipose tissue contributes to obesity-related insulin resistance , which may have parallels in guinea pig metabolism

The pharmacological responsiveness to specific agonists (BW723C86) and antagonists (SB215505) in guinea pig models provides a basis for cross-species functional comparison, though species-specific variations in binding affinity and signaling pathways likely exist.

What are the physiological roles of HTR2B in guinea pig models?

Based on the research data, HTR2B in guinea pigs serves several important physiological functions:

  • Gastrointestinal regulation: HTR2B mediates stress-induced impairment of gastric accommodation. When activated by psychological stress, HTR2B signaling inhibits normal gastric accommodation, which can be reversed by selective HTR2B antagonists .

  • Nitric oxide pathway interaction: HTR2B activation has an inhibitory effect on nitric oxide function. After meal administration, cyclic guanosine monophosphate (cGMP) levels in gastric fundus tissue increase approximately twofold in normal animals but remain unchanged in stressed animals with activated HTR2B .

  • Stress response mediation: Stress increases the responsiveness of 5-HT2B receptors, creating a mechanism by which psychological stress impacts physiological functions .

While not directly demonstrated in guinea pigs, studies in related species suggest HTR2B may also play roles in cardiac development and metabolic regulation that warrant investigation in guinea pig models.

What methodologies are most effective for studying HTR2B signaling pathways?

Several methodological approaches have proven effective for investigating HTR2B signaling pathways:

Receptor Binding and Activation Assays:

  • Radioligand binding using [3H]-labeled ligands to determine binding affinities and receptor densities

  • G-protein activation monitoring via [35S]-GTPγS binding assays

  • Phosphorylation cascade analysis for downstream targets like hormone-sensitive lipase

Pharmacological Manipulation:

  • Selective HTR2B agonists (BW723C86) to stimulate receptor function

  • Selective HTR2B antagonists (SB215505) to block receptor signaling

  • Combined application with pathway inhibitors to delineate signaling mechanisms

Physiological Function Assessment:

  • Gastric accommodation measurement through intrabag pressure recording in the proximal stomach after liquid meal administration

  • Second messenger quantification (e.g., cGMP levels) in tissue samples

  • Lipolysis assays in isolated adipocytes when studying metabolic effects

Genetic Approaches:

  • Recombinant expression systems for in vitro characterization

  • Tissue-specific knockout models to assess HTR2B function in specific cell types

  • CRISPR-Cas9 gene editing for precise receptor modifications

The choice of methodology should be tailored to the specific research question, with consideration for the physiological context in which HTR2B function is being investigated.

How does HTR2B contribute to stress-induced impairment of gastric accommodation?

HTR2B plays a central role in mediating stress-induced gastric dysfunction in guinea pigs through several mechanisms:

Experimental Evidence:

  • Water-avoidance stress significantly inhibits gastric accommodation compared to normal animals

  • The selective HTR2B antagonist SB215505 suppresses stress-induced impairment of gastric accommodation

  • The traditional Japanese medicine rikkunshito (RKT) similarly suppresses stress-induced impairment of gastric accommodation

  • At a dose that does not affect gastric accommodation in normal animals, the HTR2B agonist BW723C86 exacerbates impairment of gastric accommodation in stressed animals

Mechanistic Pathway:

  • Under normal conditions, liquid meal-induced gastric accommodation involves nitric oxide signaling

  • After meal administration, cGMP levels in gastric fundus tissue increase approximately twofold in normal animals but remain unchanged in stressed animals

  • Inhibition of gastric accommodation by a nitric oxide synthase inhibitor (L-NNA) is suppressed by either SB215505 or RKT

  • HTR2B activation appears to inhibit nitric oxide function, disrupting normal gastric accommodation

This signaling pathway represents a molecular mechanism by which psychological stress translates into physiological dysfunction, with HTR2B serving as a critical mediator between stress and gastric motility impairment.

What is the relationship between HTR2B signaling and cardiac development?

While the provided materials don't specifically address HTR2B's role in guinea pig cardiac development, mouse knockout studies provide valuable insights that may be relevant across species:

Developmental Impacts of HTR2B Deletion:

  • Ablation of 5-HT2B receptors in mice leads to partial embryonic lethality (30%) due to trabecular defects in the heart

  • 30% of HTR2B-knockout mice that reach birth develop signs of fatigue and dyspnea between postnatal days 2-5 and die within 24 hours

  • Newborn HTR2B-knockout hearts display a striking decrease in heart-to-body weight ratio (28%)

Structural Abnormalities:

  • Loss of myocardial organization and scattered areas of degenerated cardiomyocytes

  • Myofibrillar disarray with misaligned myofilaments

  • Abnormally wide Z bands and irregular mitochondria

  • Sarcomere length in mutants is 33% smaller than in control mice

  • Reduced numbers of adherens junctions and consistently disorganized intercalated disks

  • Reduced N-cadherin expression (38.8% decrease) in mutant myocardium

Functional Consequences:

  • Left ventricular dilation (LVEDD increased by 25% in male mutants)

  • Left ventricular end-systolic dimension (LVESD) increased by 50% in male mutants

  • Percent of LV fractional shortening significantly decreased (20% reduction) in male mutants

  • Developed force in response to adrenergic stimuli (isoproterenol) significantly reduced

These findings suggest HTR2B plays crucial roles in cardiac morphogenesis, cardiomyocyte organization, and contractile function that are likely conserved across mammalian species.

How can HTR2B signaling be targeted in metabolic disease research?

HTR2B has emerged as a potential therapeutic target in metabolic disease, particularly in obesity-related insulin resistance, based on several key findings:

HTR2B Expression in Metabolic Tissues:

  • Chronic high-fat diet (HFD) feeding increases Htr2b expression specifically in epididymal white adipose tissue (visceral fat)

  • HTR2B expression increases in visceral adipocytes but not in subcutaneous or brown adipocytes during HFD feeding

  • HTR2B expression in white adipose tissue is increased in obese humans and positively correlates with metabolic parameters

Metabolic Effects of HTR2B Signaling:

  • Enhanced 5-HT signaling through HTR2B directly activates lipolysis through phosphorylation of hormone-sensitive lipase in visceral adipocytes

  • This increased lipolysis leads to elevated free fatty acid release, contributing to insulin resistance

Experimental Interventions:

  • Adipocyte-specific Htr2b-knockout mice are resistant to HFD-induced insulin resistance, visceral adipose tissue inflammation, and hepatic steatosis

  • Treatment with a selective HTR2B antagonist attenuates HFD-induced insulin resistance and metabolic dysfunction

InterventionMetabolic EffectsMechanismReference
Adipocyte-specific HTR2B knockoutResistance to HFD-induced insulin resistanceReduced lipolysis in visceral adipocytes
HTR2B antagonist treatmentAttenuated insulin resistance and hepatic steatosisInhibition of HTR2B-mediated lipolysis
HFD feedingIncreased HTR2B expression in visceral fatEnhanced lipolysis and free fatty acid release

These findings suggest that HTR2B antagonists could represent novel therapeutic approaches for treating obesity-related metabolic disorders by targeting adipose tissue lipolysis.

What are the optimal expression systems for recombinant guinea pig HTR2B?

Based on the available research and standard practices for G-protein coupled receptor expression, the following expression systems are recommended for recombinant guinea pig HTR2B:

Mammalian Expression Systems:

  • Rat C6-glial cells have been successfully used for related guinea pig serotonin receptors, showing appropriate binding and signaling properties

  • HEK293 cells represent another suitable option due to their high transfection efficiency and proper protein processing

  • CHO cells offer stable expression and appropriate post-translational modifications

Expression Vector Considerations:

  • CMV promoter-driven vectors for strong constitutive expression

  • Addition of epitope tags (His, FLAG) for detection and purification

  • Inducible expression systems (tetracycline-controlled) for potentially toxic receptors

  • Codon optimization for the expression host to enhance protein yields

Stable vs. Transient Expression:

  • Stable transfection provides consistent receptor levels for reproducible assays

  • Membrane preparations of stably transfected cells can be used for binding and functional studies

  • For membrane preparations, expression levels typically range from 2-6 fmol/mg protein based on similar receptor studies

Validation Methods:

  • Radioligand binding assays to confirm receptor expression and pharmacology

  • Functional assays (G-protein activation, calcium mobilization)

  • Western blotting and immunocytochemistry for protein detection

The choice of expression system should be guided by the specific experimental requirements, with consideration for the level of expression needed, post-translational modifications, and the intended application.

What pharmacological tools are available for studying guinea pig HTR2B?

Several pharmacological tools have been validated for studying HTR2B function in guinea pig models:

Selective Agonists:

  • BW723C86: A selective 5-HT2B receptor agonist that inhibits liquid meal-induced gastric accommodation in guinea pigs

  • At lower doses that do not affect normal gastric accommodation, BW723C86 can exacerbate impairment in stressed animals

Selective Antagonists:

  • SB215505: A selective 5-HT2B receptor antagonist that suppresses stress-induced impairment of gastric accommodation

  • Effectively blocks HTR2B signaling without affecting baseline gastric function in normal animals

Natural Compounds:

  • Rikkunshito (RKT): A traditional Japanese medicine that suppresses stress-induced impairment of gastric accommodation, potentially by modulating HTR2B signaling

Pathway Modulators:

  • N-nitro-L-arginine (L-NNA): A nitric oxide synthase inhibitor that helps investigate the interaction between HTR2B signaling and nitric oxide pathways

  • 1,1-dimethyl-4-diphenylacetoxypiperidium iodide (4-DAMP): A muscarinic M3 receptor antagonist that reverses BW723C86-induced inhibition of gastric accommodation

Radioligands:

  • [3H]-5-carboxamidotryptamine (5-CT): Used for binding assays to characterize receptor properties

  • [3H]-GR 125743: Another radioligand useful for receptor binding studies

When designing pharmacological experiments, researchers should consider:

  • Dose-response relationships for each compound

  • Potential off-target effects at higher concentrations

  • Appropriate vehicle controls

  • Time course of drug action

  • Route of administration for in vivo studies

What methods are recommended for analyzing HTR2B-mediated signaling pathways?

To comprehensively analyze HTR2B-mediated signaling pathways, researchers should employ multiple complementary approaches:

G-protein Activation Analysis:

  • [35S]-GTPγS binding assays in membrane preparations to directly measure receptor-induced G-protein activation

  • Assessment of different G-protein subtypes to determine coupling specificity

Second Messenger Quantification:

  • Measurement of intracellular calcium mobilization using fluorescent indicators

  • cGMP level determination in target tissues (e.g., gastric fundus) to assess nitric oxide pathway involvement

  • Phospholipase C activity and IP3 production assessment

Protein Phosphorylation:

  • Western blot analysis using phospho-specific antibodies for downstream targets

  • Hormone-sensitive lipase (HSL) phosphorylation analysis in adipocytes

  • Kinase activation profiling (ERK, PKC, etc.)

Gene Expression Analysis:

  • qRT-PCR for HTR2B expression in different tissues under various conditions

  • RNA-seq for comprehensive transcriptomic effects of HTR2B modulation

  • Time-course analysis of gene expression changes after receptor activation

Functional Readouts:

  • Measurement of intrabag pressure in the proximal stomach to assess gastric accommodation

  • Lipolysis assays in isolated adipocytes to quantify fatty acid release

  • In vivo metabolic parameter assessment (glucose tolerance, insulin sensitivity)

Signaling PathwayAnalytical MethodFunctional ReadoutReference
G-protein activation[35S]-GTPγS bindingReceptor-G protein coupling efficiency
Nitric oxide pathwaycGMP level measurementGastric accommodation
Lipolytic signalingHSL phosphorylationFatty acid release
Cardiac developmentEchocardiographyCardiac function and morphology

Combining these approaches provides a comprehensive understanding of HTR2B signaling from receptor activation to physiological outcomes.

How should researchers interpret conflicting data regarding HTR2B function?

When confronted with conflicting data regarding HTR2B function, researchers should adopt a systematic approach to interpretation:

Biological and Methodological Variables to Consider:

  • Species differences: HTR2B function may vary between guinea pigs, mice, and humans. For example, while both guinea pig and mouse HTR2B influence physiological functions, the specific pathways and outcomes may differ .

  • Tissue-specific effects: HTR2B signaling produces different outcomes depending on the tissue context - cardiac effects in myocardium , gastric effects in stomach tissue , and metabolic effects in adipose tissue .

  • Experimental conditions:

    • Stress conditions enhance HTR2B responsiveness in gastric tissue

    • High-fat diet specifically increases HTR2B expression in visceral but not subcutaneous adipose tissue

    • Different developmental stages show varying sensitivity to HTR2B signaling

  • Pharmacological specificity:

    • Ensure that observed effects are truly HTR2B-mediated by using multiple selective agonists/antagonists

    • Consider off-target effects of pharmacological tools at higher concentrations

    • Validate pharmacological findings with genetic approaches (knockout/knockdown)

  • Sex differences: Male HTR2B-knockout mice show more pronounced cardiac effects than females , suggesting sex-specific aspects of HTR2B function.

Resolution Strategies:

  • Perform direct comparative studies under identical conditions

  • Combine pharmacological and genetic approaches to validate findings

  • Conduct dose-response studies to identify threshold effects

  • Consider temporal aspects of HTR2B signaling that may explain apparent contradictions

  • Examine whether observed differences reflect truly different functions or context-dependent manifestations of the same signaling pathway

What are the key considerations for designing HTR2B knockout or knockdown experiments?

Designing effective HTR2B knockout or knockdown experiments requires careful consideration of several factors:

Genetic Strategy Selection:

  • Global vs. Conditional Knockout:

    • Global HTR2B knockout models show embryonic and neonatal lethality (30% each) , potentially limiting adult studies

    • Conditional (tissue-specific) knockouts, such as adipocyte-specific Htr2b-KO , allow focused assessment of HTR2B function in specific tissues while avoiding developmental complications

  • Temporal Control:

    • Inducible knockout systems (e.g., tamoxifen-inducible Cre) enable distinction between developmental and acute roles of HTR2B

    • Particularly important given HTR2B's role in cardiac development

  • Species Considerations:

    • Mouse models are well-established but may not fully recapitulate guinea pig HTR2B function

    • Consider the availability of guinea pig-specific genetic tools and promoters

Experimental Design Elements:

Design ElementConsiderationsExamples from Research
Control GroupsInclude Cre-only and floxed-only controlsAdipocyte-specific Htr2b-KO studies
Phenotypic AssessmentComprehensive evaluation across multiple systemsCardiac, metabolic, and gastric function
Molecular ValidationConfirm knockout efficiency at mRNA and protein levels-
Rescue ExperimentsRe-expression of HTR2B to confirm specificity-
Compensatory MechanismsAssess changes in related receptors (e.g., other 5-HT receptors)-

Potential Challenges:

  • Embryonic/neonatal lethality in complete knockouts

  • Compensatory upregulation of related receptors

  • Potential off-target effects of genetic modification tools

  • Distinguishing primary from secondary effects

  • Reproducibility across different genetic backgrounds

Successful HTR2B knockout studies require careful selection of the genetic strategy, comprehensive phenotypic assessment, and proper controls to account for compensatory mechanisms and developmental effects.

How can researchers effectively compare HTR2B function across different disease models?

Standardized Methodology Framework:

  • Receptor Expression Profiling:

    • Quantify HTR2B expression levels (mRNA and protein) across models using identical methods

    • Assess changes in expression during disease progression

    • Example: HTR2B expression increases in visceral adipose tissue during high-fat diet feeding and may change similarly in other disease models

  • Signaling Pathway Analysis:

    • Use identical assays to measure downstream signaling events

    • Compare pathway activation kinetics and magnitude

    • Key pathways to assess include G-protein activation, nitric oxide signaling , and lipolytic pathways

  • Pharmacological Response Profiling:

    • Determine dose-response relationships for standard HTR2B ligands (BW723C86, SB215505)

    • Compare EC50/IC50 values and efficacy across models

    • Assess potential changes in drug sensitivity in disease states

Cross-Model Comparison Strategies:

Disease ModelExample HTR2B ParametersRelevant ReadoutsReference
Stress modelResponsiveness to BW723C86 in gastric functionGastric accommodation, cGMP levels
Metabolic diseaseExpression in visceral adipose tissueLipolysis, insulin sensitivity
Cardiac dysfunctionMorphological and functional cardiac parametersVentricular dimensions, contractile function

Integration Approaches:

  • Systems Biology Perspective:

    • Map HTR2B signaling networks across disease models

    • Identify common regulatory nodes and divergent pathways

    • Use computational modeling to predict cross-disease effects

  • Translational Considerations:

    • Correlate findings in animal models with human data

    • HTR2B expression in human white adipose tissue increases in obesity

    • Develop translational biomarkers that work across species and disease models

  • Therapeutic Implications Assessment:

    • Evaluate whether HTR2B modulation (antagonism/agonism) has consistent effects across disease models

    • Determine disease-specific vs. general effects of HTR2B targeting

    • Example: HTR2B antagonists improve both stress-induced gastric dysfunction and metabolic parameters in obesity

By systematically comparing HTR2B function across disease models using standardized methodologies, researchers can identify both common mechanisms and disease-specific roles, potentially leading to more targeted therapeutic approaches.

What are the most promising future directions for HTR2B research?

Based on the current state of knowledge, several promising directions for HTR2B research emerge:

  • Expanded Physiological Role Characterization:

    • Investigation of HTR2B function in guinea pig cardiac development and function, building on mouse knockout findings

    • Exploration of HTR2B's role in metabolic regulation in guinea pig models, extending findings from mouse studies

    • Further elucidation of HTR2B's role in stress resilience beyond gastric effects

  • Therapeutic Development:

    • Refinement of selective HTR2B antagonists for potential treatment of stress-related gastrointestinal disorders

    • Development of adipose-selective HTR2B modulators to target metabolic dysfunction without affecting cardiac function

    • Exploration of tissue-specific drug delivery approaches to minimize off-target effects

  • Mechanistic Investigations:

    • Detailed mapping of the crosstalk between HTR2B and nitric oxide signaling pathways

    • Characterization of the molecular mechanisms by which HTR2B regulates hormone-sensitive lipase in adipocytes

    • Investigation of HTR2B's role in cardiac development at the molecular level, particularly in cell adhesion and sarcomere organization

  • Translational Research:

    • Correlation of HTR2B expression and function between animal models and human tissues

    • Development of HTR2B-based biomarkers for stress susceptibility or metabolic dysfunction

    • Exploration of genetic variations in HTR2B and their association with disease susceptibility

  • Technical Innovations:

    • Development of guinea pig-specific genetic models for HTR2B manipulation

    • Application of advanced imaging techniques to visualize HTR2B signaling in real-time

    • Implementation of single-cell approaches to characterize HTR2B function in heterogeneous tissues

These research directions hold significant promise for advancing our understanding of HTR2B biology and developing novel therapeutic approaches for conditions ranging from stress-related disorders to metabolic diseases.

What are the critical methodological considerations for reproducible HTR2B research?

To ensure reproducibility in HTR2B research, investigators should address several critical methodological considerations:

Receptor Characterization and Expression:

  • Validate antibody specificity for guinea pig HTR2B using appropriate controls

  • Standardize receptor expression quantification methods across laboratories

  • Report detailed membrane preparation protocols, including buffer compositions and protein concentrations

  • Document expression levels (Bmax values) when using recombinant systems

Pharmacological Studies:

  • Use selective ligands at appropriate concentrations to avoid off-target effects

  • Include full dose-response curves rather than single-concentration experiments

  • Report detailed pharmacokinetic parameters when conducting in vivo studies

  • Validate compound purity and activity before experimental use

Animal Models:

  • Clearly report strain, sex, age, and housing conditions

  • Document dietary conditions precisely, especially for metabolic studies

  • Standardize stress protocols for stress-response studies

  • Control for circadian variations in serotonergic signaling

Signaling Pathway Analysis:

  • Include appropriate positive and negative controls for each assay

  • Document temporal parameters of signaling measurements

  • Report raw data alongside normalized results

  • Validate key findings using multiple methodological approaches

Statistical Considerations:

  • Perform appropriate power calculations to determine sample sizes

  • Pre-register study designs and analysis plans when possible

  • Report all experimental conditions and exclusion criteria

  • Use appropriate statistical tests and corrections for multiple comparisons

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.