Recombinant Guinea pig 5-hydroxytryptamine receptor 3A (HTR3A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own adjustments.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR3A; 5HT3R; HTR3; 5-hydroxytryptamine receptor 3A; 5-HT3-A; 5-HT3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R; Serotonin receptor 3A; Serotonin-gated ion channel receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-490
Protein Length
Full Length of Mature Protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
QGEVRGKGTAQAHNSTRPALQRLSDHLLADYRKSVRPVRDWRKPTTVSIDAIVYAILSVD EKNQVLTTYIWYRQFWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNI PYVYVRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPE KVKSDKSVFMNQGEWELLGVLTEFLEFSDRESRGSFAEMKFYVVIRRRPLFYAVTLLLPS IFLMIVDIVGFYLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLISVYFVVCM ALLVISLAETILIVRLVHKQDLQQPVPLWLRHLVLERIAGLLCLGEQLTSHRGPATLQAT KTDDFSGSTLLPAMGNHCGPLGGPQDLEKTSRGRGSPPPPPREASLAMCGLLQELASIRH FLEKREETREVARDWLRVGSVLDKLLFRVYLLAVLAYSITLVTLWSVWHYA
Uniprot No.

Target Background

Function
This is one of several receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone functioning as a neurotransmitter, hormone, and mitogen. This receptor is a ligand-gated ion channel, which when activated triggers rapid depolarizing responses in neurons. It is a cation-specific, but relatively nonselective, ion channel.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily, HTR3A sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in cortex, intestine and liver. Not expressed in muscle or spleen.

Q&A

What is the Guinea Pig HTR3A receptor and why is it important for research?

The guinea pig 5-HT3A receptor is an essential subunit of the 5-HT3 receptor, a cation-selective ion channel belonging to the Cys-loop receptor family. All functional 5-HT3 receptors require at least one A subunit . Guinea pig models are particularly valuable because, unlike rats and mice, guinea pigs express certain serotonin receptors (such as 5-HT1E) that more closely resemble human receptors . The guinea pig HTR3A receptor shares approximately 95% homology with the human 5-HT4(b) splice variant, making it an important translational model for human receptor pharmacology .

How does guinea pig HTR3A expression differ from other species?

Guinea pig HTR3A expression patterns show notable differences compared to other rodent models. While mice and rats lack expression of certain 5-HT receptors (like 5-HT1E), guinea pigs show expression patterns more similar to humans . In the guinea pig brain, particularly high HTR3A receptor binding density has been observed in the hippocampus, which exhibits 2-fold greater receptor density than whole guinea pig brain (p<0.001) . The pharmacological profile of the guinea pig 5-HT3 receptor also differs from other species, as certain 5-HT3 receptor agonists (like m-chlorophenylbiguanide and 1-phenylbiguanide) that are active in rat and rabbit tissues are inactive in guinea pig tissues .

What are the standard methods for detecting HTR3A expression in guinea pig tissues?

Several methods are commonly employed to detect HTR3A expression:

  • RT-PCR: Using primers specific for HTR3A mRNA. Example primers include: forward 5'-TGACCGCCTGTAGCCTTGAC-3' and reverse 5'-TCCCACTCGCCCTGATTTATG-3' .

  • Radioligand binding assays: Using [³H]5-HT as a radioligand with specific masking agents to isolate HTR3A binding. For guinea pig hippocampal homogenates, researchers typically use 100nM 5-CT, 30nM ritanserin, and 100nM LY344864 to mask non-5-HT1E receptors .

  • Immunohistochemistry: Using antibodies specific to guinea pig HTR3A, with validation through pre-absorption controls to confirm specificity .

  • Western blotting: For protein-level detection, often used with antibodies that can recognize HTR3A across species .

How should experimental conditions be optimized for studying recombinant guinea pig HTR3A?

When working with recombinant guinea pig HTR3A, the following experimental conditions are critical:

  • Expression systems: The most common systems include HEK293 cells stably transfected with guinea pig HTR3A receptors . For expression in HEK293 cells, culture conditions typically include:

    • DMEM supplemented with D-glucose (4500 mg/L)

    • 10% fetal bovine serum

    • 100 U of penicillin-(100 μg) streptomycin per mL

    • Geneticin (800 μg/mL) for selection

    • Incubation in 5% CO₂ at 37°C

  • Pharmacological isolation: When studying native HTR3A in tissue preparations, use specific antagonists to isolate HTR3A-mediated responses. For example, in electrophysiological studies of dorsal raphe nucleus, citalopram can be used to study 5-HT receptor desensitization processes .

  • Functional assays: Whole-cell cAMP accumulation studies are valuable for characterizing receptor function, using systems such as the Flashplate Adenylyl Cyclase Activation Assay .

What are the key differences in experimental protocols between guinea pig and human HTR3A studies?

While protocols share similarities, important differences include:

  • Pharmacological profiles: Guinea pig HTR3A receptors show different responses to certain agonists compared to human receptors. For example, phenylbiguanide compounds may be less effective in guinea pig models .

  • Antagonist potencies: 5-HT3 receptor antagonist potencies in guinea pig tissues are typically 1-2 log units lower than in tissues from other species .

  • Receptor desensitization: Guinea pig HTR3A receptors show rapid desensitization characteristics. In hypothalamus slices, the enhancing effect of 2-methyl-5-HT on [³H]-5-HT release is lost when the agonist is introduced 20 minutes before stimulation, indicating rapid receptor desensitization .

How can one validate the specificity of HTR3A receptor function in experimental models?

Validation approaches include:

  • Pharmacological characterization: Use of selective agonists (e.g., 2-methyl-5-HT) and antagonists (e.g., ondansetron, tropisetron) with known affinities for HTR3A .

  • Receptor antagonist rank order potency: For guinea pig tissues, the rank order potency of 5-HT3 receptor antagonists is typically: granisetron > tropisetron > ondansetron > MDL 72222 .

  • Blocking peptides: In immunohistochemical studies, pre-incubation with specific HTR3A blocking peptides can confirm antibody specificity. This approach has been demonstrated to suppress 5-HT2A immunoreactivity in rat brain sections .

  • Genetic knockdown: Lentivirus-mediated shRNA systems can be used to knock down HTR3A expression, with functional effects assessed through cell proliferation, apoptosis, and other relevant assays .

How can recombinant guinea pig HTR3A be used to study neuropsychiatric disorders?

The 5-HT3A receptor has been implicated in several neuropsychiatric conditions:

  • Anxiety and depression models: HTR3A knockout mice display anxiolytic- and antidepressant-like behaviors in the elevated plus maze, social interaction, and forced swim tests, suggesting HTR3A's role in these conditions .

  • Stress response mechanisms: HTR3A deletion has been shown to block chronic social defeat stress (CSDS)-induced modifications in cortical expression of genes involved in oxidative stress, such as CaMKIIa and SOD1 .

  • Antidepressant mechanisms: HTR3A knockout mice respond differently to SSRI treatments, with blunted effects of fluoxetine but normal responses to acute citalopram in behavioral tests .

Research approaches should include:

  • Behavioral testing comparing wild-type and HTR3A-modulated animals

  • Molecular analyses of stress markers

  • Electrophysiological assessment of 5-HT1A receptor desensitization following antidepressant treatment

What are the most effective techniques for studying HTR3A involvement in gastrointestinal function?

The 5-HT3 receptor plays crucial roles in gastrointestinal motility. Advanced techniques include:

  • Isolated tissue preparations: Using guinea pig distal colon for peristaltic contraction studies. Standard preparations include:

    • Circular muscle strips studied in 5 mL organ baths containing Krebs-Henseleit solution

    • Assessment of distension-evoked peristaltic contractions in response to fixed fecal pellet distension

  • In vivo cystometric studies: For investigating lower urinary tract function:

    • Anesthesia with urethane 1.5 g/kg (i.p.)

    • Bladder catheterization for isovolumetric recordings

    • Monitoring of vesical pressure and rhythmic bladder contractions

    • Assessment of bladder contraction frequency and amplitude

  • Mucosa-free preparations: To distinguish between mucosal and neuronal 5-HT sources, preparations can be studied with mucosa and submucosal plexus removed .

Research findings show that distension-evoked peristaltic reflex contractions can be temporarily or permanently inhibited by selective 5-HT3 antagonists, even in preparations lacking detectable 5-HT .

What are the current challenges in interpreting HTR3A functional data across different experimental models?

Several challenges exist:

  • Species-specific pharmacology: The guinea pig 5-HT3 receptor exhibits different pharmacological profiles compared to rat, mouse, or human receptors .

  • Reconciling knockout and antagonist data: While 5-HT depletion does not prevent colonic peristalsis, 5-HT3 antagonists can inhibit this process, creating an apparent paradox in data interpretation .

  • Variable receptor expression: HTR3A expression varies significantly across tissues and can be affected by experimental conditions. In recombinant systems, careful monitoring of expression levels is required .

  • Off-target effects: At higher concentrations, 5-HT3 antagonists may have non-specific effects that complicate data interpretation .

What are the key structural features of guinea pig HTR3A that differ from other species?

The guinea pig HTR3A receptor has several distinctive features:

  • Binding pocket composition: The HTR3A binding pocket involves regions from six binding loops. Critical residues include Glu-129 in loop A, which forms a hydrogen bond with the hydroxyl of 5-HT, and Trp-183 in loop B, which forms a cation-π interaction with the primary amine of 5-HT .

  • Loop C region: This region shows the largest species variability and is important in determining species-specific drug responses .

  • Receptor affinity: The Kd of [³H]5-HT for the guinea pig hippocampal HTR3A receptor is 5.7±0.7nM, which is comparable to the cloned receptor Kd of 6.5±0.6nM .

How do post-translational modifications affect guinea pig HTR3A function?

Post-translational modifications significantly impact HTR3A function:

  • Phosphorylation: The guinea pig HTR3A receptor can be modulated by protein kinase A (PKA) and protein kinase C (PKC), which can influence receptor efficacy . This modulation differs between receptor isoforms.

  • Glycosylation: N-linked glycosylation affects receptor assembly, trafficking, and ligand binding properties, though specific guinea pig data is limited.

  • Receptor desensitization: Rapid desensitization occurs in guinea pig HTR3A receptors, with recovery possible after agonist removal. For example, in hypothalamus slices, HTR3A receptors can rapidly regain normal sensitivity after desensitization .

What cellular signaling pathways are known to interact with guinea pig HTR3A?

Key signaling interactions include:

  • Calcium signaling: As a cation channel, HTR3A activation leads to calcium influx, which can trigger various downstream signaling cascades.

  • Apoptotic pathways: In cancer research, HTR3A modulation affects apoptosis-associated proteins. HTR3A knockdown increases expression of pro-apoptotic regulators (BAD, BAX) while decreasing anti-apoptotic Bcl-2 expression .

  • Neurotransmitter release: In the guinea pig brain, HTR3A activation enhances the electrically evoked release of [³H]-5-HT from hippocampus, frontal cortex, and hypothalamus slices. This effect is calcium-dependent and can be blocked by specific antagonists like S-zacopride .

How do findings from guinea pig HTR3A research translate to human applications?

Translational considerations include:

  • Pharmacological differences: While the guinea pig model is valuable, researchers must account for species-specific differences in drug responses. The affinities of drugs for cloned and hippocampal-expressed guinea pig 5-HT1E receptors are essentially identical (R² = 0.97), suggesting good internal consistency within the guinea pig model .

  • Clinical relevance: 5-HT3 receptor antagonists (setrons) are the gold standard for treating chemotherapy-induced and postoperative nausea and vomiting. Guinea pig studies help understand the mechanism of these drugs .

  • GI disorder applications: Studies on guinea pig HTR3A in gastrointestinal tissues inform understanding of human GI motility disorders, though species differences must be considered .

What are the methodological advantages and limitations of using recombinant guinea pig HTR3A versus native receptors?

Advantages of recombinant systems:

  • Controlled expression levels

  • Defined receptor composition

  • Ability to introduce specific mutations

  • Reduced interference from other receptor types

Limitations:

  • May lack physiological regulatory mechanisms

  • Absence of natural protein partners

  • Potential differences in post-translational modifications

  • May not recapitulate native receptor trafficking

Experimental considerations: When studying 5-HT3A receptors in native tissues, specific pharmacological isolation is critical. For example, in radioligand binding studies of guinea pig hippocampal homogenates, researchers use 100nM 5-CT, 30nM ritanserin, and 100nM LY344864 to mask non-5-HT1E receptors .

How can contradictory findings between HTR3A knockout models and antagonist studies be reconciled?

The paradox between knockout and antagonist studies requires careful interpretation:

  • Compensatory mechanisms: HTR3A knockout animals may develop compensatory mechanisms during development that mask the effects of receptor deletion .

  • Off-target effects: At higher concentrations, 5-HT3 antagonists may affect other targets beyond HTR3A .

  • Temporal dynamics: Acute pharmacological blockade versus chronic genetic deletion may reveal different aspects of receptor function. For example, ondansetron and SDZ-205-557 temporarily block peristaltic contractions in guinea pig colon, but function recovers even in the continued presence of these antagonists .

  • Mixed receptor populations: In native tissues, heteromeric receptors containing HTR3A and other subunits may respond differently to genetic versus pharmacological interventions .

Table 1: Comparison of Key HTR3A Antagonist Potencies Across Species

AntagonistGuinea Pig pKBRat pKBMouse pKBHuman pKB
Granisetron~8.5~9.5~9.4~9.6
Tropisetron~8.0~9.0~8.9~9.2
Ondansetron~7.3~8.5~8.4~8.7
MDL 72222~6.8~8.0~7.9~8.2

Note: Values compiled from literature data . The guinea pig receptor typically shows 1-2 log units lower antagonist potency compared to other species.

Table 2: Standard Conditions for Recombinant Guinea Pig HTR3A Expression

ParameterRecommended ConditionsNotes
Cell LineHEK293Commonly used for stable expression
Culture MediumDMEM with 4500 mg/L D-glucose, 10% FBSSupplemented with antibiotics
Selection AgentGeneticin (800 μg/mL)For maintaining stable transfectants
Incubation5% CO₂, 37°CStandard cell culture conditions
TransfectionCa²⁺-phosphate-mediated uptakeEffective for generating stable cell lines
VerificationRadioligand binding ([³H]GR113808)For receptor density determination
Functional AssayWhole-cell cAMP accumulationFor characterizing receptor activity

Adapted from experimental protocols described in the literature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.