Recombinant Guinea pig 5-hydroxytryptamine receptor 4 (HTR4)

Shipped with Ice Packs
In Stock

Description

Pharmacological Properties and Species Comparison

Guinea pig HTR4 shares 95% homology with the human HTR4(b) splice variant, making it a validated model for studying human therapeutics . Key comparative findings:

ParameterGuinea Pig HTR4Human HTR4(b)
Tegaserod affinitypEC₅₀ = 8.4 (full agonist)pEC₅₀ = 8.7 (full agonist)
cAMP signalingPotent adenylate cyclase activation Similar potency and intrinsic activity
Tissue vs. recombinantPartial agonist in colon LMMP (IA=66%) Full agonist in recombinant systems

These similarities validate guinea pig models for evaluating 5-HT₄-targeted prokinetic agents like tegaserod, despite differences in tissue-specific agonism .

Gastrointestinal Motility Studies

HTR4 agonists are used to treat motility disorders (e.g., irritable bowel syndrome). Recombinant guinea pig HTR4 enables mechanistic studies of serotonin-induced smooth muscle contraction and receptor desensitization .

Ligand Screening

The protein is utilized in radioligand binding assays (e.g., with [³H]GR113808) and cAMP accumulation assays to quantify agonist/antagonist efficacy .

Antibody Development

Polyclonal antibodies targeting HTR4 (e.g., ab60359) are validated for Western blot (WB) and immunocytochemistry (ICC), with cross-reactivity in zebrafish and humans .

Related Products and Reagents

ProductDescriptionSource
RFL8363MFRecombinant mouse HTR4, His-taggedCreative Biomart
HTR4-2622RRat HTR4, His-Fc-Avi-taggedMyBioSource
ab60359Rabbit anti-HTR4 antibody (aa 1–100)Abcam

Limitations and Future Directions

While recombinant guinea pig HTR4 closely mirrors human receptor pharmacology, disparities in tissue-level agonism (e.g., tegaserod’s partial efficacy in colon preparations) highlight the need for integrated in vitro and in vivo studies . Future work could explore isoform-specific roles or structure-function relationships using cryo-EM or mutagenesis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR4; 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRP QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD TVECGGQWESQCHPAASSPLVAAQPIDT
Uniprot No.

Target Background

Function
This protein is one of several receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Its activity is mediated by G proteins that stimulate adenylate cyclase.
Gene References Into Functions
  1. The 5-HT4 receptor appears to play a significant role in antigen-induced airway hyperresponsiveness (AI-AHR) to ACh in guinea-pigs. PMID: 19995401
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.

Q&A

What are the optimal expression systems for recombinant guinea pig 5-HT4 receptors?

Human embryonic kidney 293 (HEK293) cells are widely used for stable transfection of guinea pig 5-HT4 receptor cDNA. The methodology typically involves:

  • Subcloning 5-HT4 receptor cDNA into mammalian expression vectors

  • Transfection into HEK293 cells via Ca2+-phosphate-mediated uptake

  • Generation of single colonies through dilution cloning under geneticin selection

  • Identification of 5-HT4 receptor-expressing clones using selective agonists to stimulate adenylyl cyclase

  • Culture in DMEM supplemented with D-glucose (4500 mg/l), 10% fetal bovine serum, antibiotics, and geneticin (800 μg/ml) in 5% CO2 at 37°C

This approach yields stable cell lines expressing functional guinea pig 5-HT4 receptors at densities suitable for pharmacological characterization (approximately 0.2 pmol/mg protein) .

How can researchers confirm successful cloning and expression of recombinant guinea pig 5-HT4 receptors?

Validation requires multiple complementary approaches:

  • Sequence verification: Full sequencing in both forward and reverse directions to confirm identity and integrity of guinea pig 5-HT4 receptor cDNA

  • Functional validation:

    • Whole-cell cAMP accumulation assays using 5-HT4 receptor-selective agonists

    • Measurement of receptor-mediated adenylyl cyclase stimulation

  • Binding characterization:

    • Saturation binding experiments using [3H]GR113808 (selective 5-HT4 antagonist)

    • Determination of receptor density (Bmax values)

  • Pharmacological profiling:

    • Competitive binding assays to determine affinity constants (pKi values)

    • Functional assays to determine potency (pEC50) and intrinsic activity of reference compounds

How do the pharmacological properties of recombinant guinea pig 5-HT4 receptors compare to human 5-HT4 receptors?

Guinea pig and human 5-HT4 receptors share approximately 95% homology, particularly within the human 5-HT4(b) splice variant, resulting in remarkably similar pharmacological profiles:

ParameterGuinea pig 5-HT4Human 5-HT4(b)Significance
Binding affinity (pKi)Highly similar for tested ligandsReferenceSupports translational relevance
Potency (pEC50)Comparable when expressed at similar densities (~0.2 pmol/mg protein)ReferenceValidates guinea pig models for human applications
Intrinsic activityFull agonists show similar efficacyReferenceConfirms functional homology
Tegaserod potencypEC50 = 8.4 (full agonist)pEC50 = 8.7 (full agonist)Demonstrates species similarity for clinical compounds

These similarities support the use of guinea pig model systems for the identification and characterization of 5-HT4 receptor therapeutics with potential human applications .

Are there discrepancies between recombinant systems and native tissue preparations when characterizing guinea pig 5-HT4 receptors?

Important differences exist between recombinant and native systems:

  • Pharmacological discrepancies:

    • Tegaserod acts as a full agonist in recombinant systems (both guinea pig and human)

    • In guinea pig longitudinal muscle myenteric plexus (LMMP) preparations, tegaserod demonstrates potent but partial agonism (pEC50 = 8.2; intrinsic activity = 66%)

  • Mechanisms underlying differences:

    • Receptor expression levels may differ between systems

    • Signal transduction coupling efficiency variations

    • Presence of regulatory proteins in native tissues that modulate receptor function

    • Possible influence of receptor reserve in different preparations

These observations highlight the importance of evaluating compounds in both recombinant systems and native tissue preparations to fully understand their pharmacological properties and potential therapeutic efficacy .

What approaches are optimal for cloning and sequence analysis of guinea pig 5-HT4 receptors?

The established methodology involves:

  • RNA isolation and cDNA synthesis:

    • Extraction of total RNA from guinea pig striatum

    • Reverse transcription to generate cDNA library

  • PCR amplification:

    • Design of primers based on published sequence (GenBank Accession Y13585)

    • Forward primer: 5′-GTCTAGATGGACAAACTTGATGCTAATGTGAG-3′

    • Reverse primer: 5′-CTCGAGTTACTAAGTGTCAATGGGCTGAGCAGCCACCAAAGGAGAACTTGCTGCAGGG-3′

  • Cloning and verification:

    • Subcloning of amplified cDNA into appropriate vectors

    • Complete bidirectional sequencing to confirm sequence integrity

    • Comparison with published sequence data to verify identity

This approach allows for the generation of expression constructs suitable for functional studies and pharmacological characterization of guinea pig 5-HT4 receptors .

What splice variants of the guinea pig 5-HT4 receptor have been identified, and how do they compare with human variants?

Research has identified:

  • The predominant guinea pig 5-HT4 receptor sequence shares highest homology (~95%) with the human 5-HT4(b) splice variant, particularly in the C-terminal region

  • To date, fewer splice variants have been characterized in guinea pig compared to humans, where at least 11 splice variants (a-i, n, o) have been identified

  • While multiple human variants have been well-characterized (particularly 5-HT4(a), 5-HT4(b), and 5-HT4(c)), guinea pig variants require further investigation

  • The functional significance of different splice variants in guinea pig tissues remains an active area of research

Studies using recombinant systems have primarily focused on the predominant form corresponding to the human 5-HT4(b) variant due to its relevance for gastrointestinal pharmacology .

How can researchers effectively study guinea pig 5-HT4 receptor function in gastrointestinal motility?

Established methodological approaches include:

  • Isolated tissue preparations:

    • Guinea pig distal colon longitudinal muscle myenteric plexus (LMMP) preparation

    • Measurement of contractile responses using isometric force transducers

    • Evaluation of 5-HT4 receptor-mediated responses by constructing concentration-response curves

  • Reflex studies in intact preparations:

    • Three-chambered organ bath setup allowing separate superfusion of oral, middle, and anal regions

    • Monitoring of rectal contractions and internal anal sphincter relaxation

    • Assessment of ascending excitatory and descending inhibitory reflexes

  • Pharmacological interventions:

    • Application of selective 5-HT4 receptor agonists (e.g., tegaserod, mosapride)

    • Use of antagonists (e.g., GR113808, SDZ 205-557) to confirm receptor involvement

    • Calculation of reflex indices to quantify enhancement of responses

These approaches allow for detailed characterization of 5-HT4 receptor function in models relevant to gastrointestinal motility disorders .

What is the neurophysiological basis for 5-HT4 receptor involvement in ascending and descending reflexes in guinea pig intestine?

The functional role of 5-HT4 receptors in intestinal reflexes involves complex neural pathways:

  • Neuroanatomical basis:

    • 5-HT4 receptors are expressed on excitatory interneurons in the myenteric plexus

    • They modulate both ascending excitatory and descending inhibitory reflexes

  • Reflex mechanisms:

    • Ascending excitatory reflex: 5-HT3 receptors play a crucial role, while 5-HT4 receptor activation enhances but is not essential for the reflex

    • Descending inhibitory reflex: 5-HT4 receptor activation has minimal direct effect but may modulate the reflex indirectly

  • Experimental findings:

    • 5-HT4 receptor agonists (e.g., cisapride) significantly enhance ascending excitation without affecting descending inhibition

    • This enhancement can be converted to depression by selective 5-HT4 antagonists (e.g., SDZ 205-557)

    • 5-HT4 receptors appear to be located primarily on interneurons within the reflex pathway

These findings have significant implications for understanding the mechanisms of prokinetic agents that target 5-HT4 receptors for treating gastrointestinal motility disorders .

What approaches can be used to study the differential roles of 5-HT4 receptors in specific brain regions and cell types using guinea pig models?

Advanced methodological strategies include:

  • Conditional genetic targeting:

    • Generation of Cre-dependent 5-HT4 receptor knockout models

    • Use of cell type-specific Cre driver lines (e.g., Drd3-Cre for hippocampal excitatory neurons)

    • Validation of knockout efficiency using qRT-PCR with probes spanning critical exons

  • Cell type-specific molecular profiling:

    • BAC transgenic approaches to express EGFP-L10a under 5-HT4 receptor promoter control

    • Translating ribosome affinity purification (TRAP) methodology for cell type-specific transcriptomics

    • Immunohistochemical co-labeling with cell-specific markers to verify expression patterns

  • Functional characterization:

    • Electrophysiological recordings to assess changes in neuronal excitability

    • Behavioral testing to evaluate effects on mood, anxiety, and cognition

    • Analysis of neurogenesis and other cellular adaptations in specific brain regions

These approaches enable dissection of 5-HT4 receptor function in defined neural circuits and cell populations, providing insights into their role in complex behaviors and potential therapeutic applications .

How can researchers reconcile contradictory findings regarding 5-HT4 receptor function in various experimental systems?

Several methodological considerations are essential for addressing discrepancies:

  • Expression level effects:

    • Carefully control receptor density in recombinant systems (typically ~0.2 pmol/mg protein)

    • Determine receptor reserve in different preparations to interpret partial versus full agonism

    • Consider the influence of receptor density on signal transduction efficiency

  • Signal transduction context:

    • Evaluate coupling to different G proteins and downstream effectors

    • Consider the influence of regulatory proteins (e.g., GRKs, β-arrestins) on receptor function

    • Assess potential biased signaling of ligands across different pathways

  • Experimental design harmonization:

    • Standardize assay conditions (temperature, buffer composition, drug exposure times)

    • Use multiple complementary assay systems to characterize compounds

    • Include appropriate reference compounds with well-established properties

  • Cellular and tissue environment:

    • Consider differences between recombinant systems and native tissues

    • Evaluate the influence of cellular components present in native tissues but absent in recombinant systems

    • Account for potential species differences in receptor regulation and trafficking

These considerations enable more accurate interpretation of seemingly contradictory data and facilitate translation between different experimental systems .

What is the expression profile of 5-HT4 receptors in guinea pig tissues, and how can researchers effectively characterize it?

The distribution pattern of 5-HT4 receptors in guinea pig tissues can be characterized using multiple complementary approaches:

  • mRNA detection methods:

    • Quantitative RT-PCR with probes spanning different exons to detect specific splice variants

    • In situ hybridization to localize expression in specific regions and cell types

  • Protein detection:

    • Radioligand binding with selective ligands (e.g., [3H]GR113808) in membrane preparations

    • Immunohistochemistry with validated antibodies (noting challenges of specificity)

  • Functional mapping:

    • Pharmacological approaches using selective agonists and antagonists

    • Electrophysiological recording of 5-HT4 receptor-mediated responses

Key expression sites in guinea pig include:

  • CNS: Striatum, hippocampus (with differential expression along dorsoventral axis)

  • GI tract: Abundant in colon (particularly in myenteric plexus)

  • Other tissues: Relatively low expression in adult lung tissue

Understanding expression patterns is crucial for interpreting pharmacological data and designing targeted therapeutic approaches .

What developmental changes occur in 5-HT4 receptor expression in guinea pig tissues, and what are their functional implications?

Developmental regulation of 5-HT4 receptors has significant implications:

  • Expression dynamics:

    • 5-HT4 receptor expression varies across developmental stages

    • Higher expression may be observed during specific developmental windows

  • Functional significance:

    • Role in neural development and circuit formation

    • Potential involvement in developmental processes in peripheral tissues (e.g., lung)

    • Correlation with critical periods of plasticity in neural systems

  • Methodological approaches:

    • Time-course analysis of expression using qRT-PCR and binding studies

    • Functional characterization at different developmental stages

    • Conditional genetic manipulation to assess developmental roles

These developmental considerations are particularly relevant for understanding the broader physiological roles of 5-HT4 receptors beyond their acute pharmacological effects, and may inform therapeutic strategies targeting developmental processes .

What are the key methodological challenges in working with recombinant guinea pig 5-HT4 receptors, and how can they be addressed?

Researchers face several technical challenges:

  • Expression level variability:

    • Challenge: Inconsistent receptor expression can affect pharmacological parameters

    • Solution: Rigorous clonal selection and regular monitoring of expression levels using binding assays

    • Implementation: Maintain stable expression at ~0.2 pmol/mg protein for consistent results

  • Signal-to-noise ratio in functional assays:

    • Challenge: Low signal window in cAMP accumulation assays

    • Solution: Use of phosphodiesterase inhibitors (e.g., IBMX) and optimized detection methods

    • Implementation: Include appropriate positive controls and signal normalization

  • Receptor desensitization:

    • Challenge: Rapid desensitization affecting functional responses

    • Solution: Careful timing of drug application and signal measurement

    • Implementation: Time-course studies to determine optimal experimental windows

  • Splice variant heterogeneity:

    • Challenge: Potential co-expression of multiple splice variants

    • Solution: Design of specific primers and rigorous sequence verification

    • Implementation: Complete sequencing of constructs before functional studies

Addressing these challenges is essential for generating reliable and reproducible data with recombinant guinea pig 5-HT4 receptor systems .

How can researchers effectively design experiments to predict clinical efficacy of 5-HT4 receptor ligands using guinea pig models?

Translational research design requires multiple considerations:

  • Integrated multi-assay approach:

    • Combine recombinant receptor studies with native tissue preparations

    • Include both binding and functional assays to characterize compounds fully

    • Assess pharmacokinetic properties relevant to target tissues

  • Bridging parameters:

    • Determine receptor reserve in different systems to interpret partial vs. full agonism

    • Evaluate signal transduction coupling efficiency across systems

    • Account for the influence of receptor regulation mechanisms

  • In vivo validation:

    • Design appropriate in vivo models reflecting the target condition

    • Consider potential off-target effects at related receptors

    • Establish clear PK/PD relationships to guide dosing in clinical studies

  • Comparative pharmacology:

    • Include reference compounds with known clinical profiles

    • Compare results between guinea pig and human systems where possible

    • Consider species differences in drug metabolism and distribution

This comprehensive approach maximizes the translational value of preclinical data and improves prediction of clinical efficacy for 5-HT4 receptor ligands being developed as therapeutic agents .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.