Recombinant Guinea pig 5-hydroxytryptamine receptor 7 (HTR7)

Shipped with Ice Packs
In Stock

Description

Pharmacological Profile and Ligand Interactions

Recombinant HTR7 has been characterized for its ligand-binding specificity and functional activity. Key findings include:

Binding Affinity and Agonist Potency

Studies using recombinant guinea pig HTR7 in HEK293 cells or striatal membranes reveal:

LigandBinding Affinity (pKd/pKi)Functional Potency (pEC50)Intrinsic Activity
5-HT (Serotonin)~9.0~8.0Full agonist
5-CT (5-Carboxamidotryptamine)~9.5~8.5Full agonist
Tegaserod~8.4~8.2Partial agonist (66%)
SB-269970-A~8.0 (antagonist)N/AAntagonist

Data compiled from .

  • Tegaserod acts as a potent, partial agonist in guinea pig longitudinal muscle myenteric plexus preparations, contrasting with its full agonism in recombinant systems .

  • SB-269970-A is a selective antagonist with high affinity for HTR7, used to block receptor-mediated cAMP production .

Neuropsychiatric and Neurological Studies

Recombinant HTR7 models are pivotal for studying:

  • Circadian rhythms: HTR7 modulates serotonin-dependent entrainment pathways .

  • Pain perception: Altered HTR7 signaling is implicated in migraine pathophysiology .

  • Affective disorders: Links to anxiety and depression via thalamocortical signaling .

  • Autism and schizophrenia: Genetic associations suggest HTR7 as a therapeutic target .

Production and Validation

Recombinant HTR7 is synthesized via:

Host SystemExpression VectorPurification MethodYield
E. coliT7 promoter-driven plasmidNi-NTA affinity chromatographyHigh (mg-scale)
HEK293 cellsLentiviral or stable transfectionSolubilization + affinity tagsModerate (μg-scale)
Cell-Free ExpressionIn vitro transcription/translationIMAC or GST pulldownVariable (small-scale)

Validation includes:

  • Radioligand Binding: [³H]-5-CT displacement assays confirm binding specificity .

  • cAMP Accumulation: Functional assays measure Gαs-mediated signaling .

Distribution in Guinea Pig Brain

Autoradiography and in situ hybridization reveal dense HTR7 expression in:

  • Thalamic nuclei (medial regions).

  • Limbic and cortical areas (e.g., hippocampus, anterior cingulate cortex).

  • Dorsal raphe nucleus (serotoninergic cell bodies) .

This distribution aligns with roles in sensory processing and mood regulation.

Ligand-Target Interactions

  • R-lisuride: Serves as a template for CoMFA models, predicting high-affinity ligands .

  • 5-MeOT: Exhibits moderate affinity (pKd ~7.0), suggesting partial agonism .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HTR7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; 5-HT-X; Serotonin receptor 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL KLAERPERPECVLQNSDYCRKKGHDS
Uniprot No.

Target Background

Function

This receptor is one of several that bind 5-hydroxytryptamine (serotonin), a biogenic amine functioning as a neurotransmitter, hormone, and mitogen. Its activity is mediated by G proteins that stimulate adenylate cyclase.

Gene References Into Functions
  1. The 5-HT7 receptor appears to play a significant role in antigen-induced airway hyperresponsiveness (AI-AHR) to acetylcholine in guinea pigs. PMID: 19995401
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural homology between guinea pig 5-HT7 receptor and other species variants?

The guinea pig 5-HT7 receptor shows high sequence homology with 5-HT7 receptors from other species. Comparison of the amino acid sequences in the transmembrane regions indicates varying degrees of homology with other 5-HT receptors, with the highest observed with the 5-HT dro1 receptor . The receptor belongs to the G protein-coupled receptor (GPCR) family and maintains the characteristic seven-transmembrane domain structure typical of this receptor class .

The table below shows the percentage homology in transmembrane domains between different 5-HT receptors and the human 5-HT7 receptor:

ReceptorHumanRatGuinea PigMouse
5-HT dro157564842
5-HT 1A4540--
5-HT 1B504336-
5-HT 1D474336-
5-HT 1E454236-
5-HT 1F4842--
5-HT 2A3935--
5-HT 2C34---
5-HT 54632--
5-HT 644---

Are there splice variants of the guinea pig 5-HT7 receptor similar to those in other species?

While three splice variants of the 5-HT7 receptor have been identified in humans (designated 5-HT7a, 5-HT7b, and 5-HT7d), specific information about guinea pig splice variants is limited in the available literature . Human splice variants differ in their carboxy terminals: 5-HT7a is the full-length receptor (445 amino acids), 5-HT7b is truncated at amino acid 432, and 5-HT7d is a 479-amino acid receptor with a markedly different C-terminus .

While all three human splice variants constitutively activate adenylyl cyclase, inverse agonist efficacies differ between the variants . Additionally, there appears to be a difference in agonist-mediated internalization between the 5-HT7d variant and the other variants . Research specifically investigating potential splice variants in guinea pig 5-HT7 receptors would provide valuable comparative data for cross-species studies.

What is the distribution pattern of 5-HT7 receptors in the guinea pig brain?

Autoradiographic analysis reveals a discrete localization of 5-HT7 binding sites in the guinea pig brain . The highest density of these receptors is found in the medial thalamic nuclei and related limbic and cortical regions . Moderate levels are detected in sensory relay nuclei, substantia nigra, hypothalamus, central grey, and dorsal raphe nuclei .

This distribution pattern has been confirmed using in situ hybridization with [35S]-UTP labeled riboprobes complementary to mRNA encoding the guinea pig 5-HT7 receptor . The predominance of these receptors in thalamocortical and limbic brain regions suggests their involvement in sensory processing and affective behaviors . This anatomical distribution provides important clues about the functional role of 5-HT7 receptors in the central nervous system.

What are the primary signaling pathways associated with the guinea pig 5-HT7 receptor?

The guinea pig 5-HT7 receptor, like its counterparts in other species, primarily couples to the stimulation of adenylyl cyclase via Gs proteins, leading to increased cAMP production . The EC50 values for reference agonists such as 5-CT, 5-HT, and 8-OH-DPAT vary between species, with guinea pig 5-HT7 receptors showing distinct pharmacological profiles .

Beyond the canonical Gs-coupled pathway, 5-HT7 receptors can activate the extracellular signal-related kinase (ERK) through a mechanism dependent on Ras G protein . Additionally, evidence suggests that 5-HT7 receptors can stimulate ERK through a protein kinase A (PKA)-independent pathway, possibly involving the cAMP-guanine nucleotide exchange factor Epac .

In cell lines, the 5-HT7 receptor has been shown to activate not only the adenylyl cyclase AC5 normally linked to Gs but also cyclases AC1 and AC8 that are activated by intracellular calcium . The coexpression of the 5-HT7 receptor, AC1, and AC8 in the hippocampus may be important for hippocampal function .

How do agonists and antagonists interact with guinea pig 5-HT7 receptors?

Guinea pig 5-HT7 receptors exhibit high affinity for 5-CT (pKi 9.4) and 5-HT (pKi 9.0) . The pharmacological profile of guinea pig 5-HT7 receptors shows some differences compared to human, rat, and mouse variants, as detailed in the following table:

LigandHumanRatMouseGuinea pig
5-CT9.09.89.09.4
Methiothepin8.49.48.28.0
5-MeOT8.39.28.29.0
Metergoline8.28.27.5-
5-HT8.18.88.39.0
Methysergide7.17.97.97.4
8-OH-DPAT6.37.56.67.3
Sumatriptan6.06.65.76.6

The selective 5-HT7 receptor antagonist SB-269970-A potently displaces [3H]-5-CT from guinea pig 5-HT7 receptors in cortex (pKi 8.3±0.2), though with slightly lower affinity than for human 5-HT7(a) receptors (pKi 8.9±0.1) . In functional assays, SB-269970-A inhibits 5-CT-stimulated adenylyl cyclase activity with a pA2 value (8.5±0.2) that agrees well with the pKi determined from binding studies .

What techniques can be used to characterize recombinant guinea pig 5-HT7 receptors?

Several experimental approaches have proven effective for characterizing recombinant guinea pig 5-HT7 receptors:

Radioligand binding assays: Under appropriate conditions, [3H]-5-CT can label a single population of 5-HT7 receptors in guinea pig cerebral cortex membranes . For selective labeling, the assay should include (-)-cyanopindolol (1.0 μM) and sumatriptan (1.0 μM) to block binding to other receptor subtypes . Under these conditions, [3H]-5-CT binds with high affinity (Kd = 0.76 ± 0.28 nM by equilibrium saturation; Kd = 0.18 ± 0.05 nM by kinetic analysis) .

Adenylyl cyclase activity assays: Functional responses can be measured by assessing 5-CT-stimulated adenylyl cyclase activity in membrane preparations from cells expressing recombinant guinea pig 5-HT7 receptors or in native tissues such as guinea pig hippocampus . This approach allows for determination of agonist potency (EC50 values) and assessment of antagonist affinity through inhibition of agonist-stimulated responses .

Expression systems: CHO-K1 cells have been used successfully to express recombinant guinea pig 5-HT7 receptors , while HEK293 cells have been employed for human 5-HT7 receptor variants . These expression systems provide platforms for pharmacological characterization and functional studies.

How can one differentiate 5-HT7 receptor-mediated effects from those of other serotonin receptors?

Differentiating 5-HT7 receptor-mediated effects from those of other serotonin receptors requires careful experimental design and selective pharmacological tools:

Selective antagonists: SB-269970-A has emerged as a selective 5-HT7 receptor antagonist that can be used to block 5-HT7-mediated effects . The use of such selective antagonists in functional assays allows for the identification of responses specifically mediated by 5-HT7 receptors.

Pharmacological profiling: Utilizing compounds with differential affinities for various 5-HT receptor subtypes can help distinguish 5-HT7-mediated effects . By comparing the rank order of potency of a series of agonists or antagonists with their known affinities for different receptor subtypes, one can identify the receptor likely mediating the observed effects.

Recombinant receptor systems: Expression of recombinant guinea pig 5-HT7 receptors in cell lines provides a clean system for characterizing receptor-specific responses without interference from other receptor subtypes . Comparing responses in these systems with those observed in native tissues can help identify 5-HT7-specific effects.

What methods are appropriate for studying 5-HT7 receptor-mediated signaling in native guinea pig tissues?

When studying 5-HT7 receptor-mediated signaling in native guinea pig tissues, several approaches are effective:

Adenylyl cyclase activity assays: Measuring 5-CT-stimulated adenylyl cyclase activity in guinea pig hippocampal membranes provides a functional readout of 5-HT7 receptor activation . The inclusion of selective antagonists for other serotonin receptor subtypes can help isolate 5-HT7-specific responses.

Autoradiography: [3H]-5-CT binding in the presence of blockers for other receptor subtypes allows for visualization of 5-HT7 receptor distribution in brain sections . This technique can be combined with functional studies to correlate receptor density with functional responses in specific brain regions.

In situ hybridization: Using riboprobes complementary to mRNA encoding the guinea pig 5-HT7 receptor allows for visualization of receptor expression patterns . This technique is valuable for correlating receptor expression with functional responses.

How do mutations in the 5-HT7 receptor affect ligand binding and signaling?

Studies of mutations in human 5-HT7 receptors provide insights into structure-function relationships that may be applicable to guinea pig receptors. Two notable mutations identified in the human 5-HT7 receptor gene lead to amino acid exchanges with functional consequences :

  • The Thr92Lys exchange results in decreased agonist binding without affecting antagonist binding . This suggests differential molecular determinants for agonist versus antagonist recognition.

  • The Pro279Leu variant exhibits virtually abolished signal transduction, likely due to altered coupling between the third intracellular loop and the G protein . This highlights the importance of this region for receptor-G protein interactions.

These findings suggest that similar mutations in guinea pig 5-HT7 receptors might yield comparable effects, though direct studies would be necessary to confirm this. Site-directed mutagenesis of recombinant guinea pig 5-HT7 receptors would provide valuable information about structure-function relationships specific to this species variant.

What is the role of post-translational modifications in 5-HT7 receptor function?

Post-translational modifications significantly influence 5-HT7 receptor function. One important modification is palmitoylation of the C-terminal domain, which has been demonstrated to regulate the constitutive activity of the 5-HT7 receptor . This lipid modification likely affects receptor conformation and interaction with signaling partners.

Additionally, the association of 5-HT7 receptors with regulatory proteins influences their function. All three human splice variants have been associated with a protein known as PLAC-24 that might regulate transportation and stabilization of newly synthesized receptor protein . Similar regulatory mechanisms may exist for guinea pig 5-HT7 receptors.

How can 5-HT7 receptors be targeted in models of neuropsychiatric disorders?

Given the distribution of 5-HT7 receptors in thalamocortical and limbic brain regions, these receptors represent promising targets for investigating mechanisms and potential treatments for neuropsychiatric disorders . The availability of selective antagonists such as SB-269970-A facilitates such investigations .

Studies using genetic models (such as receptor knockout approaches) and pharmacological manipulations with selective ligands can help elucidate the role of 5-HT7 receptors in various disorders. The guinea pig offers advantages as a model system due to the pharmacological similarity of its 5-HT7 receptors to human receptors and the detailed characterization of receptor distribution in brain regions relevant to neuropsychiatric function .

How do guinea pig 5-HT7 receptors compare pharmacologically to those of other species?

Guinea pig 5-HT7 receptors show distinct pharmacological properties compared to those of other species, though many features are conserved. As shown in the binding affinity table in section 2.2, some notable differences include:

  • Guinea pig 5-HT7 receptors exhibit relatively high affinity for the endogenous agonist 5-HT (pKi 9.0), compared to human (pKi 8.1) and mouse (pKi 8.3) receptors .

  • The partial agonist 8-OH-DPAT shows moderate affinity for guinea pig 5-HT7 receptors (pKi 7.3), higher than for human receptors (pKi 6.3) but lower than for rat receptors (pKi 7.5) .

  • The selective antagonist SB-269970-A binds with slightly lower affinity to guinea pig 5-HT7 receptors (pKi 8.3±0.2) than to human 5-HT7(a) receptors (pKi 8.9±0.1) .

These pharmacological differences should be considered when extrapolating findings across species or when using guinea pig models to investigate 5-HT7 receptor function in relation to human disorders.

What are the optimal conditions for radioligand binding studies with guinea pig 5-HT7 receptors?

For optimal radioligand binding studies with guinea pig 5-HT7 receptors, the following conditions have been established:

  • [3H]-5-CT is an effective radioligand for labeling guinea pig 5-HT7 receptors .

  • To ensure selectivity, the binding assay should include (-)-cyanopindolol (1.0 μM) and sumatriptan (1.0 μM) to block binding to other receptor subtypes .

  • Under these conditions, [3H]-5-CT labels a single population of high-affinity binding sites (Kd = 0.76 ± 0.28 nM; Bmax = 68.1 ± 26.7 fmol mg-1 protein) .

  • The binding is rapid, saturable, and reversible, making it suitable for both equilibrium and kinetic analyses .

These optimized conditions enable reliable characterization of guinea pig 5-HT7 receptors in both recombinant systems and native tissues, facilitating comparative pharmacological studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.