Recombinant Guinea pig Alpha-2C adrenergic receptor (ADRA2C)

Shipped with Ice Packs
In Stock

Description

Ligand Binding and Signaling

  • ADRA2C inhibits adenylyl cyclase via Gᵢ/o proteins, reducing intracellular cAMP levels .

  • Exhibits high affinity for noradrenaline (pKᵢ = 7.2 in humans) , though guinea pig variants show reduced sensitivity to yohimbine due to a critical amino acid substitution in the fifth transmembrane domain .

Biological Roles

  • Modulates sympathetic tone by regulating neurotransmitter release in the heart and central nervous system .

  • Postjunctional α2C-adrenoceptors mediate vasoconstriction in peripheral arteries .

Expression and Reconstitution

  • Expressed in E. coli for cost-effective, high-yield production .

  • Reconstitution requires sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) to enhance stability .

Quality Control

  • Validated via SDS-PAGE (≥90% purity) and functional assays (e.g., cAMP inhibition) .

  • Avoid repeated freeze-thaw cycles; store at -20°C/-80°C in aliquots .

Comparative Analysis Across Species

Recombinant ADRA2C has been produced in multiple species, highlighting interspecies variability:

SpeciesHost SystemPurityKey Use Cases
Guinea pig E. coli≥90%Ligand-binding studies, functional assays
Human Cell-free expression≥85%Structural studies, drug screening
Rat Cell-free expression≥85%Comparative pharmacology

Pathway Involvement

  • Adrenergic Signaling: Regulates adrenaline/noradrenaline-induced inhibition of insulin secretion .

  • Vascular Function: Mediates endothelial responses in porcine models .

Experimental Tools

  • Used in radioligand binding assays, Western blotting, and functional studies (e.g., cAMP modulation) .

  • Compatible with antibody-based detection (e.g., Rabbit anti-ADRA2C IgG) .

Key Challenges and Considerations

  • Species-Specific Pharmacology: Guinea pig α2C receptors (α2D subtype) differ from human α2A in ligand selectivity .

  • Stability: Requires glycerol supplementation for long-term storage .

Future Directions

Current research focuses on:

  • Resolving cryo-EM structures to map ligand-binding pockets.

  • Developing subtype-selective agonists/antagonists for cardiovascular and neurological disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
ADRA2C; Alpha-2C adrenergic receptor; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-455
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MASPALAAALLAAEGPNASGAGEGGGGVNASGAVWGPPPSQYSAGAVAGLAAVVGFLIVF TVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWC GVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAIISF PPLVSFYRQPDGAAYPRCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTL SEKRGPAGPEGESPTTENGLGAAAAAAAGENGHCAPPRADVEPDESSAAERRRRRGALRR GARQREAGVEAPGPGLGSAAADPGALSVSRSPGPGGRLSRASSRSVEFFLSRRRRARSSV CRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPTPLFKFFFWIGY CNSSLNPVIYTIFNQDFRRSFKHILFRRRRRGFRQ
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2C sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How are alpha-2 adrenergic receptor subtypes classified and what distinguishes ADRA2C from other subtypes?

Alpha-2 adrenergic receptors are classified into four subtypes: α2A, α2B, α2C, and α2D, based on their distinct pharmacological properties . The α2C subtype exhibits unique binding characteristics and distribution patterns compared to other subtypes. Unlike α2A receptors which are prominently found on substance P-containing primary afferent fibers in the spinal cord, α2C receptors show differential distribution patterns and are expressed by distinct neuronal populations, suggesting specialized physiological functions . This classification is critical for designing subtype-selective experimental approaches and understanding receptor-specific signaling pathways.

What expression systems are optimal for recombinant guinea pig ADRA2C production?

  • Bacterial expression optimization: Growth temperature (typically 25-30°C), induction conditions (IPTG concentration of 0.1-1.0 mM), and harvest timing significantly impact receptor yield and proper folding.

  • Alternative expression systems: For studies requiring post-translational modifications, mammalian expression systems (HEK293, CHO cells) may be preferable despite lower yields .

  • Membrane protein solubilization: Optimized detergent compositions (typically containing CHAPS, DDM, or digitonin) are essential for maintaining receptor integrity during extraction from bacterial membranes.

The selection of expression system should align with specific experimental requirements, particularly regarding protein folding, post-translational modifications, and functional assay compatibility.

What purification strategies yield functional recombinant guinea pig ADRA2C?

Purification of functional recombinant guinea pig ADRA2C typically employs affinity chromatography utilizing the N-terminal His tag . A comprehensive purification protocol should include:

  • Membrane preparation: Careful cell lysis and membrane fraction isolation using differential centrifugation.

  • Solubilization: Optimization of detergent type, concentration, and buffer components to maintain receptor conformation.

  • Affinity purification: Nickel-NTA chromatography with imidazole gradient elution (typically 20-250 mM) for His-tagged ADRA2C.

  • Quality assessment: Size-exclusion chromatography to verify monodispersity, followed by functional binding assays.

The purified protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability . Addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C, with 50% being the default final concentration to prevent freeze-thaw degradation .

How can binding properties of recombinant guinea pig ADRA2C be accurately assessed?

Binding properties of recombinant guinea pig ADRA2C can be characterized using radioligand binding assays. Based on established protocols with alpha-adrenergic receptors, researchers should consider:

  • Radioligand selection: While [³H]-WB4101 has been used for alpha-1 adrenergic receptors in guinea pig with a dissociation constant (Kd) of 1.23 nM , subtype-selective ligands such as [³H]-idazoxan may be more appropriate for α2C receptor characterization with proper controls to distinguish from imidazoline binding sites.

  • Assay conditions: Optimal conditions include:

    • Membrane protein concentration: 50-200 μg/mL

    • Incubation temperature: 25°C

    • Incubation time: 45-60 minutes

    • Buffer composition: 50 mM Tris-HCl, pH 7.4, containing 5 mM MgCl₂

  • Analysis parameters: Determine key pharmacological parameters including:

    • Maximal binding capacity (Bmax)

    • Dissociation constant (Kd)

    • Competitive binding profiles with selective antagonists

For comprehensive binding characterization, saturation binding experiments should be conducted alongside competitive displacement assays using subtype-selective compounds to establish receptor pharmacology.

What signaling pathways are coupled to guinea pig ADRA2C and how can they be studied?

Guinea pig ADRA2C couples primarily to Gi/o proteins, resulting in inhibition of adenylyl cyclase and subsequent reduction in cAMP levels. Studies of beta-adrenergic receptors have established methodological frameworks applicable to alpha-receptors with appropriate modifications . Key experimental approaches include:

  • G-protein coupling assays:

    • [³⁵S]GTPγS binding assays to measure receptor-mediated G-protein activation

    • Pertussis toxin (PTX) sensitivity tests to confirm Gi/o coupling

  • Second messenger analysis:

    • Measurement of cAMP levels using ELISA or FRET-based biosensors

    • Monitoring of inhibition of forskolin-stimulated adenylyl cyclase activity

  • Downstream signaling assessment:

    • Evaluation of MAPK pathway activation (particularly ERK1/2)

    • Measurement of ion channel modulation (particularly K⁺ channels)

Pathway analysis should incorporate specific inhibitors such as PTX for Gi protein and appropriate controls including receptor-selective antagonists like ICI118551 (used in β2-AR studies) to establish signaling specificity and potential crosstalk mechanisms.

How do the pharmacological properties of guinea pig ADRA2C differ from other species?

Guinea pig ADRA2C exhibits distinct pharmacological properties compared to the same receptor subtype in other species, reflecting evolutionary adaptations and potential research considerations:

SpeciesBinding Affinity (Ki) Range for Key LigandsNotable Pharmacological Distinctions
Guinea pigData obtained through comparative analysisUnique C-terminal region; differential response to certain imidazoline compounds
RatReference values from established literatureHigher binding affinity for yohimbine derivatives
HumanReference values from established literatureDistinct allosteric modulation properties; clinical relevance
RabbitDetermined through cloning and expression studiesSequence variations affecting antagonist binding profiles

These species differences must be considered when extrapolating experimental findings across species or developing selective compounds. Notably, the differential binding profiles appear to be influenced by variations in the C-terminal region and transmembrane domains, particularly TM5 and TM6 .

What antibodies and immunological tools are available for guinea pig ADRA2C research?

Several validated antibodies are available for guinea pig ADRA2C research, with important considerations for experimental design:

  • Validated antisera: Anti-peptide antisera generated against the C-terminal portion of α2C-adrenergic receptors show reliable specificity when properly validated . The staining patterns of antisera directed against the α2C-AR derived from both rabbits and guinea pigs were indistinguishable in comparative studies, indicating consistent epitope recognition .

  • Cross-reactivity assessment: Thorough validation using cell lines transfected with different α2-AR subtypes (α2A, α2B, α2C) is essential to ensure subtype specificity . Preabsorption controls with specific peptides corresponding to the α2C-AR and related subtypes should be performed to confirm antibody specificity .

  • Immunohistochemical applications: For tissue localization studies, optimized protocols include:

    • Fixation in 4% paraformaldehyde

    • Permeabilization with 0.3% Triton X-100

    • Blocking with appropriate serum (5-10%)

    • Primary antibody incubation at 4°C for 24-48 hours

    • Detection using suitable secondary antibodies and visualization systems

These immunological tools have been successfully applied to differentiate α2A and α2C receptor distributions in neural tissues, revealing distinct expression patterns .

How can recombinant guinea pig ADRA2C be used to study receptor distribution in neural tissues?

Recombinant guinea pig ADRA2C can serve as a valuable tool for studying receptor distribution through several methodological approaches:

  • Generation of subtype-selective antisera: The recombinant protein can be used to develop and validate antisera against the C-terminus of the α2C-AR, enabling precise immunohistochemical localization studies . These antisera allow researchers to distinguish between α2A-AR and α2C-AR distributions in neural tissues.

  • Tissue distribution analysis: Studies indicate that unlike α2A-AR (found primarily on substance P-containing primary afferent fibers), guinea pig α2C-AR shows distinct distribution patterns not associated with primary afferent origin or substance P immunoreactivity . This differential localization suggests specialized roles in neural function.

  • Colocalization studies: Dual-labeling protocols combining α2C-AR antibodies with markers for neuronal subtypes (such as enkephalin) have revealed that α2C-AR may be expressed by specific subsets of interneurons rather than astrocytes or descending noradrenergic terminals .

These distribution studies provide critical insights into the potential functional roles of α2C-AR in neural circuits, informing the design of targeted pharmacological interventions.

What role does guinea pig ADRA2C play in cardiac function and how can it be investigated?

While β2-adrenergic receptors have been extensively studied in cardiac function, α2C-adrenergic receptors also play important regulatory roles that can be investigated using similar methodological approaches with appropriate modifications:

  • Cardiac electrophysiology studies: Techniques such as Langendorff preparation and programmed electrical stimulation can assess parameters including:

    • Effective refractoriness period (ERP)

    • Corrected QT interval (QTc)

    • Action potential duration (APD)

    • Ventricular arrhythmia incidence

    These parameters have been successfully measured in guinea pig heart failure models when studying β2-AR effects and similar approaches can be adapted for α2C-AR investigations.

  • Signaling pathway analysis: Investigation of α2C-AR signaling in cardiac tissues should examine:

    • Gs/cAMP/PKA pathway modulation

    • Gi/PDE pathway interactions

    • Ion channel regulation (particularly Ikr)

    Studies with β-adrenergic receptors have demonstrated that pathway-specific inhibitors (Rp-cAMP for cAMP, KT5720 for PKA, PTX for Gi protein, and amrinone for PDE III) can effectively isolate signaling components .

  • Receptor-mediated cardioprotection assessment: Evaluation of α2C-AR-mediated effects on:

    • Ischemia/reperfusion injury

    • Cardiomyocyte calcium handling

    • Mitochondrial function

These investigations provide insights into the potential therapeutic relevance of α2C-AR modulation in cardiac conditions.

How can structural biology approaches be applied to study guinea pig ADRA2C?

Advanced structural biology techniques offer powerful approaches for investigating guinea pig ADRA2C structure-function relationships:

  • Cryo-electron microscopy (cryo-EM): Requires:

    • High-purity recombinant receptor (>95% homogeneity)

    • Stabilization in appropriate detergent-lipid micelles

    • Sample vitrification and imaging at 300kV

    This approach can reveal the three-dimensional receptor structure, particularly when combined with selective ligands to capture different conformational states.

  • X-ray crystallography: Though challenging for GPCRs, successful crystallization strategies include:

    • Thermostabilizing mutations

    • Fusion partners (T4 lysozyme, BRIL)

    • Lipidic cubic phase crystallization

    • Antibody fragment co-crystallization

  • Molecular dynamics simulations: Based on homology models derived from related receptors with known structures, simulations can predict:

    • Ligand binding modes

    • Conformational changes during activation

    • Species-specific structural differences

These structural approaches complement pharmacological and functional studies, providing atomic-level insights into receptor mechanism and species differences.

What are the current challenges and future directions in guinea pig ADRA2C research?

Current challenges and emerging research directions include:

  • Subtype selectivity: Development of highly selective ligands that can distinguish between closely related α2-adrenergic receptor subtypes remains challenging. Future research should focus on:

    • Structure-based drug design targeting species-specific receptor regions

    • Allosteric modulators with enhanced subtype selectivity

    • Biased ligands that selectively activate specific signaling pathways

  • Physiological relevance: While distribution studies suggest distinct roles for α2C-AR compared to other subtypes , further research is needed to:

    • Define specific physiological functions in different tissues

    • Understand the significance of species variations in receptor pharmacology

    • Determine potential therapeutic implications of selective targeting

  • Technical advancements: Emerging technologies hold promise for addressing current limitations:

    • CRISPR/Cas9 gene editing for developing improved animal models

    • Advanced imaging techniques (super-resolution microscopy, PET ligands)

    • Single-cell analysis methods to resolve cell-type specific expression patterns

These research directions will advance our understanding of guinea pig ADRA2C biology and potentially reveal new therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.