Recombinant Guinea pig ATP-sensitive inward rectifier potassium channel 11 (KCNJ11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ11; ATP-sensitive inward rectifier potassium channel 11; IKATP; Inward rectifier K(+ channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
KCNJ11
Target Protein Sequence
MLSRKGIIPEEYVLTRLAEDPTEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTTVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTSQAHRRAET LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIYHVIDANSPLYDLGPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGHRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTAHQLDEDHSLLDALT LASTRGPLRKRSVPVAKAKPRFSISPDSLS
Uniprot No.

Target Background

Function

This G protein-coupled receptor belongs to the family of inward rectifier potassium channels. These channels exhibit a preference for potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification primarily results from intracellular magnesium block of outward current. The channel is susceptible to blockade by extracellular barium. KCNJ11 can form cardiac and smooth muscle-type KATP channels in conjunction with ABCC9. KCNJ11 forms the channel pore, while ABCC9 is essential for activation and regulation.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ11 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is KCNJ11 and what is its primary function in guinea pigs?

KCNJ11 encodes the ATP-sensitive inward rectifier potassium channel 11, also known as Kir6.2. This integral membrane protein forms a critical component of ATP-sensitive potassium (KATP) channels, which couple cellular metabolism with membrane excitability. The protein has a greater tendency to allow potassium to flow into a cell rather than out of it, with voltage dependence regulated by extracellular potassium concentration . As external potassium rises, the voltage range of channel opening shifts to more positive voltages . KATP channels are found in pancreatic β-cells, neurons, heart, and skeletal and smooth muscle, where they serve as metabolic sensors by linking intracellular ATP levels to membrane potential .

How does the structure of guinea pig KCNJ11 compare to human KCNJ11?

The guinea pig (Cavia porcellus) KCNJ11 protein consists of 390 amino acids and shares significant homology with human KCNJ11 . The guinea pig protein sequence (UniProt ID: Q9JHJ9) includes key functional domains such as transmembrane regions and nucleotide-binding sites that are conserved across species . Unlike the stronger inward rectifier channels (Kir2.x), KATP channels containing KCNJ11 form weak inwardly rectifying channels, allowing for decreased but still substantial outward current flow at positive potentials compared to inward current . This property is essential for the channel's physiological function in metabolic sensing.

What is the functional significance of the G-loop in KCNJ11?

While the G-loop has been extensively studied in Kir2.1 channels, similar structural elements exist in KCNJ11. The G-loop contributes significantly to inward rectification properties . The narrowest part of the G-loop in Kir channels is typically made up of specific amino acids that, when mutated, can drastically alter channel conductance. Substitutions that result in physical occlusion of the G-loop without changing its backbone conformation can abolish current flow . In guinea pig KCNJ11, this structural feature is crucial for proper channel gating and rectification properties.

What are the recommended protocols for expressing recombinant guinea pig KCNJ11 in heterologous systems?

For optimal expression of recombinant guinea pig KCNJ11, researchers should consider the following methodological approach:

  • Expression System Selection: Xenopus oocytes or mammalian cell lines (HEK293, CHO) are preferred .

  • Vector Construction: Use mammalian expression vectors with strong promoters (CMV or SV40).

  • Co-expression: For functional KATP channels, co-express KCNJ11 with the appropriate sulfonylurea receptor (SUR) subunit . For pancreatic-type channels, use SUR1; for cardiac-type channels, use SUR2A.

  • Transfection Optimization: For transient expression, lipofection or electroporation protocols should be optimized for each cell type.

  • Expression Verification: Confirmation can be performed via western blotting using guinea pig anti-Kir6.2 antibodies .

For patch-clamp electrophysiology, inside-out patch configurations allow exposing the intracellular side of the channel to bath solutions containing varying ATP concentrations, which is crucial for characterizing ATP sensitivity .

What electrophysiological techniques are most appropriate for studying guinea pig KCNJ11 channel properties?

For comprehensive characterization of guinea pig KCNJ11 channel properties, the following electrophysiological approaches are recommended:

Patch-Clamp Configurations:

  • Inside-out patch: Ideal for studying ATP sensitivity and modulation by intracellular factors .

  • Whole-cell recording: Suitable for assessing macroscopic currents and pharmacological responses.

  • Cell-attached recording: Useful for studying channel activity under near-physiological conditions .

Key Parameters to Measure:

  • Single-channel conductance: Typically 70-85 pS in cardiac myocytes under symmetrical 140-150 mM [K+] conditions .

  • Inward rectification properties: Assess voltage-dependent block by internal Mg2+ and polyamines .

  • ATP sensitivity: Determine IC50 values for ATP inhibition.

  • Pharmacological responses: Test sensitivity to sulfonylureas and KATP channel openers.

The current-voltage relationship should be carefully analyzed to characterize the inward rectification, with attention to outward currents being significantly smaller than inward currents as the membrane potential becomes progressively positive to the reversal potential of K+ .

How should researchers prepare and store recombinant guinea pig KCNJ11 protein to maintain optimal stability and activity?

For optimal stability and activity of recombinant guinea pig KCNJ11 protein:

Storage Conditions:

  • Store at -20°C in a Tris-based buffer containing 50% glycerol .

  • For extended storage, conserve at -80°C .

  • Avoid repeated freezing and thawing, which significantly reduces protein stability and function .

  • For working solutions, prepare aliquots and store at 4°C for up to one week .

Handling Recommendations:

  • When diluting samples for experiments, pre-experiment with neat (undiluted) samples or 1:2-1:4 dilutions .

  • Avoid diluting samples more than 1:10 as this may compromise activity .

  • Include appropriate protease inhibitors when extracting or working with the protein from cellular systems.

  • Always maintain the protein in an appropriate buffer system optimized for stability.

How can guinea pig KCNJ11 be used to model human MODY and neonatal diabetes?

Guinea pig KCNJ11 serves as a valuable model for studying human diabetes, particularly MODY (Maturity-Onset Diabetes of the Young) and neonatal diabetes, due to the following methodological considerations:

  • Pathogenic Variants: Mutations in KCNJ11 cause decreased insulin secretion from pancreatic beta cells by conferring reduced ATP sensitivity, resulting in a gain of channel function . This leads to cell membrane hyperpolarization and various glucose metabolic abnormalities.

  • Experimental Approach:

    • Generate recombinant guinea pig KCNJ11 with mutations corresponding to human pathogenic variants

    • Express these mutants in pancreatic beta cell lines or primary islet cultures

    • Assess insulin secretion in response to glucose stimulation

    • Measure KATP channel activity using patch-clamp electrophysiology

    • Test sulfonylurea responsiveness, as these drugs can restore function in some KCNJ11 mutations

  • Translational Relevance: The effectiveness of sulfonylureas in treating KCNJ11-related diabetes supports the pathogenicity of specific variants. Patients with KCNJ11-MODY may be treated with as little as 0.02-0.03 mg/kg/d of glibenclamide , information that can guide treatment protocols in human patients.

A notable example from clinical research showed that a novel heterozygous variant (c.153G>C, p.Glu51Asp) in KCNJ11 resulted in MODY, with sulfonylurea administration achieving adequate glycemic control .

What are the key differences between cardiac and pancreatic KATP channels containing guinea pig KCNJ11?

The functional differences between cardiac and pancreatic KATP channels stem primarily from their association with different sulfonylurea receptor subunits:

ParameterCardiac KATP ChannelsPancreatic KATP Channels
CompositionKir6.2 (KCNJ11) + SUR2AKir6.2 (KCNJ11) + SUR1
Single-channel conductance70-85 pS55-65 pS
ATP sensitivityModerateHigh
Sulfonylurea sensitivityLowerHigher
Physiological roleProtects against ischemiaRegulates insulin secretion
ExpressionCardiomyocytesPancreatic β-cells

For experimental studies:

  • Cardiac model: Co-express guinea pig KCNJ11 with SUR2A in expression systems to reconstitute cardiac-type KATP channels .

  • Pancreatic model: Co-express guinea pig KCNJ11 with SUR1 to reconstitute pancreatic-type KATP channels .

The differential response to pharmacological agents can be used to distinguish between these channel types in functional studies .

How can researchers effectively analyze inward rectification properties of guinea pig KCNJ11 compared to other Kir channels?

To analyze the inward rectification properties of guinea pig KCNJ11 compared to other Kir channels, researchers should implement the following methodological approach:

  • Voltage-clamp protocols:

    • Apply voltage steps from -140 mV to +60 mV

    • Measure steady-state currents at each potential

    • Plot current-voltage relationships to quantify rectification

  • Rectification analysis:

    • Calculate the rectification index (RI = I+40mV/I-100mV) under symmetrical K+ conditions

    • KCNJ11 (Kir6.2) shows weak inward rectification (higher RI) compared to strong inward rectifiers like Kir2.1

  • Structural determinants:

    • Examine the contribution of the G-loop to rectification properties

    • Analyze the role of charged residues facing the cytoplasmic pore

    • Investigate the impact of the diaspartate cluster that faces the cytoplasmic pore

  • Physiological modulators:

    • Test the effects of internal Mg2+ (0.1-1.0 mM) on outward currents

    • Examine polyamine (spermine, spermidine) block at different concentrations

    • Compare sensitivity to these blockers between KCNJ11 and other Kir channels

For comparison, large-conductance inward rectifier channels in guinea-pig cardiomyocytes (34.0 pS) correspond to gpKir2.2, while intermediate-conductance (23.8 pS) and low-conductance (10.7 pS) channels may correspond to gpKir2.1 and gpKir2.3, respectively .

What are the most effective methods for studying PIP2 interactions with guinea pig KCNJ11?

Phosphatidylinositol 4,5-bisphosphate (PIP2) interaction is critical for KCNJ11 function. To effectively study these interactions:

These methods allow comprehensive analysis of how PIP2 interactions regulate guinea pig KCNJ11 and how these interactions may be modified by physiological and pathological conditions.

What approaches should be used to investigate the interaction between SUR subunits and guinea pig KCNJ11?

To investigate SUR-KCNJ11 interactions in guinea pig models, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged versions of guinea pig KCNJ11 and SUR subunits

    • Perform Co-IP using antibodies against either protein

    • Analyze complex formation by western blotting

    • Compare interaction strength between different SUR isoforms (SUR1 vs. SUR2A)

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescently tagged constructs (e.g., KCNJ11-CFP and SUR-YFP)

    • Measure FRET efficiency to assess proximity and interaction

    • Perform FRET measurements under different conditions (ATP concentrations, pharmacological agents)

  • Functional electrophysiology:

    • Express KCNJ11 alone or with different SUR subunits

    • Compare ATP sensitivity, rectification properties, and single-channel kinetics

    • Study pharmacological responses (sulfonylureas bind to SUR while glinides and ATP bind to KCNJ11)

    • Create chimeric SUR constructs to map interaction domains

  • Cross-linking studies:

    • Use chemical cross-linkers of different lengths to identify interacting regions

    • Perform mass spectrometry to identify cross-linked peptides

    • Map the interaction interface between SUR and KCNJ11

  • Cryo-electron microscopy:

    • Purify the KATP channel complex (KCNJ11 + SUR)

    • Determine the structure at high resolution

    • Identify molecular details of the interaction

Remember that the KATP channel is an octameric complex with four KCNJ11 subunits forming the channel pore and four SUR subunits providing regulatory functions . The pancreatic KATP channel is composed of KCNJ11 and SUR1, while the cardiac KATP channel consists of KCNJ11 and SUR2A complexes .

What are the common issues in patch-clamp studies of guinea pig KCNJ11 and how can they be resolved?

When conducting patch-clamp studies of guinea pig KCNJ11, researchers frequently encounter these challenges:

  • Channel rundown:

    • Problem: KATP channel activity decreases after patch excision (channel run-down) .

    • Solution: Channel activity can be maintained by re-applying Mg-ATP, suggesting phosphorylation is required . Include 0.3-1.0 mM Mg-ATP in the bath solution periodically.

  • Variable ATP sensitivity:

    • Problem: Inconsistent IC50 values for ATP inhibition between experiments.

    • Solution: Carefully control intracellular pH and Mg2+ concentration, as these affect ATP binding. Ensure complete washout of ATP between applications and maintain consistent temperature throughout recordings.

  • Low expression levels:

    • Problem: Insufficient channel density for reliable recordings.

    • Solution: Optimize transfection protocols, ensure co-expression of SUR subunits, and include a fluorescent marker to identify transfected cells. Consider using inducible expression systems for better control.

  • Distinguishing endogenous from recombinant channels:

    • Problem: Native Kir channels may interfere with recordings.

    • Solution: Use cell lines with minimal endogenous K+ channel expression. Alternatively, introduce mutations that alter pharmacological sensitivity or single-channel conductance as an experimental tag.

  • Cellular metabolic state effects:

    • Problem: Variations in cellular metabolism affect KATP channel activity.

    • Solution: Standardize cell culture conditions and recording solutions. For inside-out patches, use defined ATP concentrations in the bath solution.

When analyzing data from KATP channel recordings, employ rigorous statistical methods and always include appropriate controls to account for these variables.

How can researchers distinguish between KCNJ11 mutations that cause neonatal diabetes versus those that cause MODY?

Distinguishing between KCNJ11 mutations that cause neonatal diabetes versus MODY requires systematic functional and clinical analysis:

  • Functional characterization:

    • Electrophysiology: Measure the degree of gain-of-function in KATP channels containing mutant KCNJ11

    • ATP sensitivity: Neonatal diabetes mutations typically show severely reduced ATP sensitivity compared to MODY mutations, which display moderate reductions

    • Channel kinetics: Analyze open probability and burst duration of single channels

    • Sulfonylurea response: Test effectiveness of different sulfonylurea concentrations

  • Structural analysis:

    • Map mutations to specific functional domains of KCNJ11

    • Neonatal diabetes mutations often affect the ATP-binding pocket or gating mechanisms

    • MODY mutations may be located in regions affecting channel regulation or trafficking

  • Genotype-phenotype correlation:

    • Document clinical presentation, age of onset, and severity of hyperglycemia

    • Analyze family history and inheritance patterns

    • For example, the mutation c.153G>C (p.Glu51Asp) was associated with MODY and responsive to low-dose sulfonylurea treatment (0.02-0.03 mg/kg/d)

  • Response to therapy:

    • Test sulfonylurea sensitivity in vitro and correlate with clinical response

    • Document dose-response relationships

    • Monitor long-term glycemic control with different treatment regimens

  • Comparison table for analysis:

ParameterNeonatal Diabetes MutationsMODY Mutations
Age of onsetDays to months after birthChildren, adolescents, young adults
ATP IC50Greatly increased (>10-fold)Moderately increased (2-5 fold)
Open probabilityMarkedly increasedModestly increased
Sulfonylurea dose requiredHigherLower (0.02-0.03 mg/kg/d)
Mutation locationOften in ATP-binding sitesVariable locations
Clinical severitySevere, persistent hyperglycemiaMild to moderate hyperglycemia

This comprehensive approach allows researchers to accurately classify KCNJ11 mutations and guide appropriate therapeutic strategies.

What are promising approaches for developing tissue-specific modulators of guinea pig KCNJ11?

Developing tissue-specific modulators for guinea pig KCNJ11 represents an important research frontier with therapeutic potential. Several promising approaches include:

  • Exploiting SUR subunit differences:

    • Design compounds that selectively target SUR1 (pancreatic) versus SUR2A (cardiac) complexes with KCNJ11

    • Develop allosteric modulators that alter KCNJ11 function in a SUR-dependent manner

    • Create bivalent ligands that simultaneously interact with both KCNJ11 and specific SUR isoforms

  • Targeting tissue-specific auxiliary proteins:

    • Identify proteins that associate with KATP channels in specific tissues

    • Design peptides or small molecules that modulate these protein-protein interactions

    • Exploit differences in the KATP channel interactome between tissues

  • Conditional modulation strategies:

    • Develop compounds activated by tissue-specific enzymes or conditions

    • Create prodrugs converted to active compounds only in target tissues

    • Design pH-sensitive modulators that function differently in various cellular environments

  • Biased KATP channel modulators:

    • Develop compounds that selectively affect certain functional properties (e.g., ATP sensitivity vs. open probability)

    • Create state-dependent modulators that preferentially bind to specific conformational states

    • Design compounds that alter specific aspects of channel gating without affecting others

  • Targeted delivery approaches:

    • Employ nanoparticles or liposomes for tissue-specific delivery

    • Design antibody-drug conjugates targeting tissue-specific epitopes near KATP channels

    • Utilize cell-penetrating peptides modified for tissue selectivity

These approaches could lead to more selective treatments for KCNJ11-related diseases like diabetes, avoiding unwanted effects in other tissues expressing these channels.

How can guinea pig models help advance our understanding of KCNJ11 mutations in human disease?

Guinea pig models offer valuable insights into KCNJ11-related human diseases through several methodological advantages:

  • Evolutionary conservation and divergence:

    • Guinea pig epiblast stem cells (gpEpiSCs) share transcriptional similarities with human primed stem cells

    • Species-specific differences in pluripotency-related pathways can inform human disease mechanisms

    • Comparative studies between guinea pig and human KCNJ11 highlight conserved pathogenic mechanisms

  • Functional genomics applications:

    • Generate guinea pig models with human KCNJ11 mutations using CRISPR/Cas9

    • Create isogenic cell lines differing only in specific KCNJ11 variants

    • Perform comprehensive phenotyping at molecular, cellular, and physiological levels

  • Translational research potential:

    • Test novel therapeutics targeting mutant KCNJ11 channels

    • Evaluate sulfonylurea responsiveness of different mutations in vivo

    • Investigate long-term consequences of KCNJ11 dysfunction

  • Methodological advantages:

    • Guinea pigs provide sufficient tissue for detailed biochemical and electrophysiological studies

    • Their larger size compared to mice facilitates physiological measurements

    • Their metabolic characteristics more closely resemble humans in certain aspects

  • Disease modeling applications:

    • Study the impact of KCNJ11 mutations on pancreatic development

    • Evaluate effects on cardiac function during metabolic stress

    • Investigate neurological manifestations of KCNJ11 mutations (which occur in some human cases)

Recent research demonstrated that guinea pig pluripotent stem cells can differentiate into the three germ layers, maintain normal karyotypes, and express key pluripotency markers (OCT4, SOX2, NANOG) , providing a valuable platform for studying development-related aspects of KCNJ11 function and dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.