Recombinant Guinea pig Brain protein I3 (I3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Guinea Pig Brain Protein I3

Recombinant I3 is a full-length (1–125 amino acids) protein derived from guinea pig brain tissue, expressed in E. coli and purified with an N-terminal His tag for affinity chromatography . Its UniProt identifier is Q99N46, and it shares >90% sequence identity with human, mouse, and rat homologs . Originally identified in murine brain tissue, I3 is now recognized for its broader roles in immune responses and cellular trafficking .

Immune System Involvement

I3 is implicated in delayed-type hypersensitivity (DTH) reactions, a cell-mediated immune response. Its mRNA and protein are detected in spleen cells, macrophages, and skin-infiltrating cells but absent in thymic cells . This suggests a role in peripheral immune cell activation rather than T-cell development.

Cellular Localization and Trafficking

  • Surface Expression: Partial membrane localization, inferred from sequence motifs .

  • Intracellular Trafficking: GFP-tagged I3 exhibits particulate cytoplasmic localization, colocalizing with lysosomes and late endosomes. This aligns with conserved endosomal/lysosomal-targeting motifs in its sequence .

Cross-Species Conservation

SpeciesSequence IdentityKey Reference
Human>90%
Mouse>90%
Rat>90%

Applications in Research

ApplicationDetails
SDS-PAGEPurity validation and structural analysis
Immune Response StudiesInvestigating DTH reactions and granule-related functions
Antibody DevelopmentServes as a target for anti-I3 antibodies (e.g., HPA042215, 14591-1-AP)

Key Discoveries

  1. Tissue Expression: I3 mRNA is widely expressed in guinea pig tissues, including spleen, liver, and lung, despite its initial association with brain .

  2. Protein Localization: GFP-I3 colocalizes with lysosomal markers, suggesting involvement in vesicular trafficking or granule secretion .

  3. Functional Motifs: Endosomal/lysosomal-targeting motifs in I3’s sequence hint at roles in membrane remodeling or cargo sorting .

Unresolved Questions

  • Exact Mechanism: How does I3 regulate trafficking between lysosomes, endosomes, and the plasma membrane?

  • Pathological Roles: Potential links to immune disorders or neurodegenerative diseases remain unexplored.

References

  1. Creative Biomart. (2025). Recombinant Full Length Guinea Pig Brain Protein I3 (I3) Protein, His-Tagged.

  2. Nakada-Tsukui et al. (2009). Characterization of a cDNA Encoding Guinea Pig I3 Associated with DTH. Zoological Science, 26(9).

  3. Nakada-Tsukui et al. (2009). I3 Localization in Immune Cells. BioOne.

  4. Nakada-Tsukui et al. (2009). Endosomal/Lysosomal Colocalization of I3. BioOne.

  5. Sigma-Aldrich. (2025). BRI3 Gene Overview.

  6. Proteintech. (2025). BRI3 Antibody (14591-1-AP).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
I3; Brain protein I3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
I3
Target Protein Sequence
MDHKPLLQERPPAYNLEAGQGDYACGAPGYGAIPSAPPPPPYPYLVTGIPTPHPRVYSIH SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC GATFT
Uniprot No.

Target Background

Function

Recombinant Guinea pig Brain protein I3 (I3) participates in tumor necrosis factor-alpha (TNF)-induced cell death. It may also be a target of Wnt/β-catenin signaling in the liver.

Database Links
Protein Families
BRI3 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is Guinea pig Brain protein I3 and where was it originally identified?

Guinea pig Brain protein I3 was initially identified as a gene expressed in mouse brain, but subsequent research has demonstrated that it is widely expressed in various guinea pig tissues and immune cells. The protein encodes a polypeptide of 125 amino acids, and its amino acid sequence shows over 90% identity to human, mouse, and rat I3 proteins . Despite its name suggesting brain-specific expression, I3 has been found in numerous tissues, including immune cells such as spleen cells and macrophages, but is notably low in thymic cells . This widespread distribution suggests that I3 may have broader physiological roles than initially anticipated.

What is the cellular localization of Guinea pig Brain protein I3?

Guinea pig Brain protein I3 demonstrates a complex subcellular distribution pattern. Research utilizing fluorescent tagging has revealed that part of the I3 protein localizes to the cell surface membrane, while a significant portion shows particulate localization in the cytoplasm . Specifically, fluorescent microscopy studies with green fluorescent protein (GFP)-tagged I3 have shown that the protein partly colocalizes with lysosomes and late endosomes . This dual localization pattern is consistent with the presence of typical endosomal/lysosomal-targeting motifs in the I3 protein sequence, suggesting it may shuttle between the plasma membrane and intracellular compartments as part of its functional role.

How do I validate antibodies against Guinea pig Brain protein I3?

Validating antibodies against Guinea pig Brain protein I3 requires a multi-step approach:

  • Western blot analysis: Test the antibody against recombinant I3 protein and guinea pig tissue lysates (especially brain, spleen, and macrophage extracts) to confirm specificity based on molecular weight.

  • Immunocytochemistry: Perform immunostaining of cells known to express I3 (based on mRNA detection) and verify the expected subcellular localization patterns (membrane and cytoplasmic puncta colocalizing with endosomal/lysosomal markers).

  • Negative controls: Include thymic cells which show minimal I3 expression as negative controls in validation experiments .

  • Cross-reactivity assessment: Due to the high sequence homology (>90%) with human, mouse, and rat I3 proteins, evaluate potential cross-reactivity with these species, which may be advantageous for comparative studies.

  • Blocking peptides: Use specific peptide competition assays to confirm antibody specificity.

What are the best experimental models for studying Guinea pig Brain protein I3 function?

Based on current understanding of I3 expression and function, several experimental models can be considered:

  • Primary guinea pig cells: Macrophages and spleen cells show strong I3 expression and represent physiologically relevant models .

  • Brain-derived cell cultures: Given I3's original identification in brain tissue, primary neuronal cultures or brain slice preparations from guinea pigs would be appropriate for studying its neuronal functions.

  • Delayed-type hypersensitivity (DTH) model: Since I3 has been identified as a gene associated with the guinea pig skin DTH reaction, this immunological model provides a functional context for studying I3 .

  • Heterologous expression systems: Transfection of I3 constructs (wild-type or tagged versions) into cell lines with low endogenous expression allows for controlled functional studies and protein interaction analyses.

  • Subcellular fractionation: Given I3's localization in endosomal/lysosomal compartments, fractionation approaches can be used to study its distribution and trafficking dynamics.

How can I design RNA interference experiments to study Guinea pig Brain protein I3 function?

RNA interference (RNAi) experiments to study I3 function require careful design considering several methodological aspects:

  • Target sequence selection: Design multiple siRNA sequences targeting different regions of the I3 mRNA, avoiding regions with high homology to other transcripts. Given the high conservation across species, examine alignment with related species' I3 sequences to identify guinea pig-specific regions.

  • Delivery methods:

    • For primary guinea pig macrophages, nucleofection or specialized transfection reagents designed for primary cells are recommended

    • For brain cells, consider lentiviral delivery systems which provide sustained expression and higher efficiency in neuronal cells

  • Controls:

    • Include non-targeting siRNA controls with similar GC content

    • Create rescue experiments with RNAi-resistant I3 constructs containing silent mutations in the target sequence

  • Validation of knockdown:

    • Measure I3 mRNA reduction by quantitative PCR

    • Confirm protein reduction via Western blot or immunofluorescence

    • For partial localization phenotypes, quantitative image analysis of the cytoplasmic particulate distribution versus membrane localization

  • Functional readouts:

    • Assessment of endosomal/lysosomal trafficking using pulse-chase experiments with fluorescent markers

    • Analysis of plasma membrane protein composition and turnover rates

    • Evaluation of immune cell functions in the context of DTH responses

What are the recommended approaches for studying protein-protein interactions involving Guinea pig Brain protein I3?

Several complementary approaches are recommended for comprehensive analysis of I3 protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against endogenous I3 or epitope-tagged versions

    • Perform reciprocal Co-IPs to confirm interactions

    • Consider chemical crosslinking prior to cell lysis to capture transient interactions

    • Include appropriate controls including IgG controls and I3-negative cell lysates

  • Proximity labeling techniques:

    • BioID or TurboID fusion constructs with I3 to identify proteins in close proximity in living cells

    • APEX2-based proximity labeling for temporal control of labeling reactions

    • These approaches are particularly valuable for identifying interactions within endosomal/lysosomal compartments

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET) between I3 and candidate interactors

    • Fluorescence Lifetime Imaging Microscopy (FLIM) for quantitative analysis

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in specific subcellular locations

  • Mass spectrometry-based interactomics:

    • Quantitative approaches comparing I3 immunoprecipitates with controls

    • Analysis under different cellular conditions (resting vs. stimulated)

    • Differential interactome analysis between wild-type I3 and mutants lacking specific domains or motifs

  • Yeast two-hybrid screening:

    • Consider membrane yeast two-hybrid systems given I3's membrane association

    • Split-ubiquitin systems may be particularly suitable for membrane-associated proteins

How can I investigate the role of Guinea pig Brain protein I3 in endosomal/lysosomal trafficking?

Given I3's localization to endosomal/lysosomal compartments, the following methodological approaches are recommended:

  • Live-cell imaging of labeled I3:

    • Generate fluorescent protein fusions maintaining proper targeting motifs

    • Perform time-lapse microscopy to track I3-positive vesicles

    • Use photoactivatable or photoswitchable fluorescent proteins to follow specific vesicle populations

  • Colocalization studies:

    • Quantitative colocalization analysis with established markers of the endocytic pathway

    • Multiple markers should be used including Rab5 (early endosomes), Rab7 (late endosomes), LAMP1 (lysosomes)

    • Super-resolution microscopy techniques can provide detailed spatial relationships

  • Cargo trafficking assays:

    • Monitor internalization and degradation of model cargoes (e.g., transferrin, EGF, dextran)

    • Pulse-chase experiments with fluorescently labeled or biotinylated cargoes

    • Quantify kinetics of internalization, recycling, and degradation in cells with normal or altered I3 levels

  • pH-sensitive probes:

    • Use ratiometric pH sensors to measure vesicular pH in I3-positive compartments

    • Monitor pH changes during vesicle maturation and trafficking

  • Dominant-negative approach:

    • Express I3 mutants lacking specific functional domains or with mutated targeting motifs

    • Analyze their effects on endosomal morphology and function

What is the recommended workflow for identifying post-translational modifications of Guinea pig Brain protein I3?

A comprehensive workflow for identifying post-translational modifications (PTMs) of I3 includes:

  • In silico prediction:

    • Use bioinformatic tools to predict potential phosphorylation, glycosylation, ubiquitination, and other modification sites

    • Compare predictions across species given the high conservation of I3 sequence

  • Enrichment strategies:

    • Immunoprecipitation of I3 from different cellular compartments

    • Phosphoprotein enrichment using TiO₂ or IMAC for phosphorylation studies

    • Lectin affinity chromatography for glycosylation analysis

    • Di-Gly remnant antibodies for ubiquitination sites

  • Mass spectrometry analysis:

    • Use multiple proteases to increase sequence coverage

    • Employ fragmentation methods optimized for PTM analysis (ECD, ETD, HCD)

    • Consider top-down proteomics approaches for intact protein analysis

    • Targeted MS approaches (PRM, MRM) for quantitative analysis of specific modifications

  • Functional validation:

    • Generate site-specific mutants (phospho-null, phospho-mimetic)

    • Compare localization, stability, and interaction profiles of wild-type and mutant proteins

    • Assess the effect of specific PTM-inducing conditions (e.g., cellular stress, immune activation)

  • Dynamic PTM profiling:

    • Analyze temporal changes in PTMs during cellular processes

    • Compare PTM profiles across different tissues and cell types

    • Evaluate the interplay between different types of modifications

How should I design expression constructs for recombinant Guinea pig Brain protein I3?

When designing expression constructs for recombinant I3, several factors should be considered:

  • Vector selection:

    • For mammalian expression, vectors with CMV or EF1α promoters typically yield good expression

    • For bacterial expression, consider fusion partners (such as MBP, GST, or SUMO) to improve solubility

    • For structural studies, lentiviral vectors may provide more physiological expression levels

  • Tagging strategies:

    • C-terminal tags are generally preferred as they avoid disrupting N-terminal targeting sequences

    • For endosomal/lysosomal proteins like I3, verify that tags do not interfere with targeting motifs

    • Consider small epitope tags (FLAG, HA, V5) for applications where protein size matters

    • For localization studies, fluorescent protein fusions should be tested against antibody detection to confirm normal localization

  • Codon optimization:

    • For heterologous expression, codon optimization may improve yields

    • For mammalian expression of guinea pig I3, consider human-optimized codons given the high sequence similarity

  • Purification considerations:

    • Include a TEV or PreScission protease cleavage site if tag removal is desired

    • For membrane-associated proteins like I3, include detergent screening in purification optimization

  • Sequence verification:

What are common pitfalls in studying Guinea pig Brain protein I3 and how can they be addressed?

Several technical challenges may be encountered when studying I3:

  • Cross-reactivity issues:

    • Due to high sequence conservation, antibodies may cross-react with human or rodent I3

    • Solution: Use knockout or knockdown controls to verify antibody specificity

    • Validate antibodies with recombinant proteins from multiple species

  • Subcellular fractionation artifacts:

    • I3's dual localization (membrane and vesicular) can complicate fractionation analysis

    • Solution: Use multiple fractionation methods and verify with microscopy

    • Include markers for plasma membrane, endosomes, and lysosomes in all analyses

  • Expression level artifacts:

    • Overexpression may disrupt normal localization and function

    • Solution: Use inducible expression systems to titrate expression levels

    • Compare with endogenous protein expression patterns

  • Guinea pig-specific technical limitations:

    • Fewer genetic tools available compared to mouse or human research

    • Solution: Adapt techniques from related species

    • Consider developing species-specific tools when critical

  • Functional redundancy:

    • I3 may have functional redundancy with related proteins

    • Solution: Consider combinatorial knockdown approaches

    • Perform comparative studies across multiple cell types with different expression profiles

How can I address contradictory results in studies of Guinea pig Brain protein I3 function?

When facing contradictory results in I3 research, a systematic approach is recommended:

  • Cell type differences:

    • I3 functions may vary across cell types

    • Solution: Thoroughly characterize expression levels and localization patterns in each model system

    • Document cell culture conditions in detail, including passage number and cell density

  • Methodological variations:

    • Different detection methods may yield apparently contradictory results

    • Solution: Apply multiple independent techniques to validate key findings

    • Consider the limitations of each method (sensitivity, specificity, resolution)

  • Data analysis approaches:

    • Different analysis methods can lead to divergent interpretations

    • Solution: Use standardized analysis pipelines

    • Share raw data and analysis code when publishing

  • Protein interaction context:

    • Interactions and functions may be context-dependent

    • Solution: Carefully control cellular state (e.g., confluence, activation status)

    • Characterize temporal dynamics rather than single time points

  • Systematic validation framework:

    • Develop a validation hierarchy with multiple levels of evidence

    • Combine in vitro and cellular approaches

    • When possible, validate in primary cells and tissues

How can CRISPR-Cas9 technology be applied to study Guinea pig Brain protein I3?

CRISPR-Cas9 approaches offer powerful tools for studying I3:

  • Genome editing strategies:

    • Design multiple gRNAs targeting exons of the I3 gene

    • For guinea pig cells, consider using species-specific optimization of CRISPR components

    • HDR templates should include 800-1000bp homology arms for efficient knock-in

  • Functional domain analysis:

    • Generate precise deletions or mutations of targeting motifs

    • Create domain swaps to investigate functional conservation across species

    • Engineer reporter knock-ins at the endogenous locus

  • Delivery considerations:

    • For primary guinea pig cells, nucleofection of ribonucleoprotein complexes often provides optimal efficiency

    • For in vivo applications, AAV-delivered CRISPR systems may be considered

    • Testing multiple delivery methods is essential for optimization

  • Screening considerations:

    • Design PCR-based screening strategies for edited clones

    • Include restriction sites in HDR templates to facilitate screening

    • Confirm edits by sequencing and protein expression analysis

  • Off-target analysis:

    • Perform whole-genome sequencing of edited cell lines to identify potential off-target effects

    • Use multiple independent clones for functional studies to control for clonal variation

What are the emerging technologies that could advance our understanding of Guinea pig Brain protein I3?

Several cutting-edge technologies hold promise for advancing I3 research:

  • Cryo-electron microscopy:

    • Structural determination of I3 in membrane or vesicular contexts

    • Visualization of I3-containing protein complexes

    • Analysis of conformational states during trafficking processes

  • Proteomics approaches:

    • Proximity-dependent biotin identification (BioID) to map the spatial environment of I3

    • Thermal proteome profiling to identify I3 interactors and substrates

    • Crosslinking mass spectrometry to capture transient interactions

  • Advanced imaging techniques:

    • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

    • Super-resolution microscopy (STORM, PALM, STED) for detailed localization studies

    • Correlative light and electron microscopy (CLEM) to connect functional imaging with ultrastructural analysis

  • Single-cell analysis:

    • Single-cell proteomics to examine I3 expression heterogeneity

    • Spatial transcriptomics to map I3 expression in complex tissues

    • Live-cell single-molecule tracking to follow individual I3 molecules

  • Organoid technologies:

    • Brain organoids to study I3 in a more physiological neural environment

    • Immune organoids to investigate I3's role in immune cell development and function

    • Multi-organ systems to examine tissue-specific functions

How can computational approaches enhance Guinea pig Brain protein I3 research?

Computational methods offer valuable complementary approaches to experimental studies:

  • Protein structure prediction:

    • Use AlphaFold2 or RoseTTAFold to generate structural models of I3

    • Molecular dynamics simulations to investigate conformational dynamics

    • Predict interaction interfaces and binding pockets

  • Network analysis:

    • Integrate proteomic and transcriptomic data to place I3 in functional networks

    • Compare networks across species to identify conserved modules

    • Predict functional relationships based on co-expression patterns

  • Machine learning applications:

    • Develop predictive models for I3 localization based on sequence features

    • Automated image analysis for high-throughput phenotyping

    • Mining literature and databases for hidden relationships

  • Systems biology approaches:

    • Mathematical modeling of I3-dependent trafficking pathways

    • Sensitivity analysis to identify critical parameters in I3 function

    • Integration of multiple data types for comprehensive understanding

  • Evolutionary analysis:

    • Comparative genomics to identify conserved functional elements

    • Positive selection analysis to highlight functionally important residues

    • Reconstruction of ancestral sequences to understand functional evolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.