Recombinant Guinea pig Calcitonin receptor (CALCR)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Guinea Pig CALCR

The recombinant guinea pig calcitonin receptor (CALCR) is a genetically engineered protein produced to study the structure, function, and signaling mechanisms of this G protein-coupled receptor (GPCR). CALCR plays a critical role in calcium homeostasis, bone metabolism, and neuroendocrine regulation . The guinea pig variant is particularly valuable for translational research due to physiological similarities to humans in calcitonin response pathways .

Molecular Characterization

The guinea pig CALCR was cloned via degenerate reverse transcription-polymerase chain reaction (RT-PCR) from brain tissue and functionally expressed in COS-1 cells . Key features include:

  • Amino Acid Length: 490 residues (predicted molecular weight: ~57 kDa; observed: ~70 kDa due to post-translational modifications) .

  • Ligand Specificity: Exhibits high affinity for salmon calcitonin (EC₅₀ = 0.1 nM for cAMP activation) but low potency for human calcitonin (EC₅₀ = 27.6 nM) .

  • Signaling Pathways: Activates both cAMP and phosphatidylinositol hydrolysis cascades .

Production Systems

Recombinant guinea pig CALCR is produced in multiple expression systems, as detailed below:

Product CodeExpression SystemPurityApplication
CSB-CF004439GUE. coli (in vitro)>85%Functional assays
CSB-YP004439GU1Yeast>80%Structural studies
CSB-EP004439GU1E. coli (Biotinylation)>90%Protein interaction

Source: CUSABIO

Functional Assays

  • Receptor Activation: Salmon calcitonin binding induces cAMP accumulation (EC₅₀ = 0.1 nM) and phosphatidylinositol hydrolysis (EC₅₀ = 2.5 nM) .

  • Ligand Screening: Used to evaluate synthetic analogs for osteoporosis therapies .

Neuroendocrine Studies

  • CALCR in the medial preoptic area (MPOA) mediates affiliative social behaviors in rodents, with amylin-CALCR signaling linked to stress responses .

Tissue Distribution

  • High Expression: Diencephalon, renal tubules, and osteoclasts .

  • Low Expression: Peripheral neurons and pancreatic β-cells .

Pathophysiological Relevance

  • Bone Resorption: CALCR activation inhibits osteoclast activity, making it a therapeutic target for osteoporosis .

  • Social Behavior Modulation: CALCR-amylin interactions in the MPOA regulate stress-induced social contact-seeking in guinea pigs .

Future Directions

  • Drug Development: Dual amylin-calcitonin receptor agonists for metabolic disorders .

  • Neurological Research: Role of CALCR in maternal adaptation and stress coping mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify your requirements when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CALCR; Calcitonin receptor; CT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-478
Protein Length
Full Length of Mature Protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
LPRSENLTFPTFEPEPYLYSVGRKKLVDAQYRCYDRMQQLPPYEGEGPYCNRTWDGWMCW DDTPAGVLSVQLCPDYFPDFDPTEKVTKYCDESGVWFKHPENNRTWSNYTLCNAFTPEKL QNAYVLYYLAIVGHSMSIITLVVSLGIFVYFRSLGCQRVTLHKNMFLTYILNSMIIIIHL VEVVPNGELVRKDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVSVFNEAKHLRWY YLLGWGFPLVPTTIHAITRALYFNDNCWISVDTHLLYIIHGPVMVALVVNFFFLLNIVRV LVTKMRETHEAESYMYLKAVKATMILVPLLGIQFVVFPWRPSNKVLGKIYDYFMHSLIHF QGFFVATIYCFCNNEVQTTLKRQWAQFKIQWNQRWGTRPSNRSAAARAAAAAAEAGGDNI PVYICHQEPRNDPPNNQGEEGAEMIVLNIIEKESSA
Uniprot No.

Target Background

Function
This receptor functions as a receptor for calcitonin. Its activity is mediated by G proteins that activate adenylyl cyclase. The calcitonin receptor is believed to couple with the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the guinea pig calcitonin receptor and how does it differ from other species?

The guinea pig calcitonin receptor (CALCR) is a G protein-coupled receptor that was cloned from guinea pig brain using degenerate reverse transcription-polymerase chain reaction (RT-PCR) strategy . One of the most notable characteristics of the guinea pig CALCR is its distinctive pharmacological profile compared to other species. When transfected into COS 1 cells, the guinea pig CALCR responds to salmon calcitonin with remarkably high potency (EC50 of 0.1 nM), while showing substantially reduced sensitivity to human calcitonin which is >250-fold less potent (EC50 27.6 nM) . This distinctive pharmacological profile makes it valuable for comparative receptor studies and understanding the evolution of calcitonin receptor biology across species.

What signaling pathways are activated by the guinea pig calcitonin receptor?

The guinea pig calcitonin receptor activates multiple signaling pathways when stimulated with appropriate ligands. Primary signal transduction occurs through:

  • cAMP pathway: Stimulation with salmon calcitonin leads to intracellular cyclic AMP accumulation with an EC50 of 0.1 nM .

  • Phospholipid signaling: The receptor also triggers phosphatidylinositol hydrolysis with an EC50 of 2.5 nM when stimulated with salmon calcitonin .

This dual coupling capability indicates that the guinea pig CALCR can activate both Gs and Gq/11 G-protein pathways, making it a valuable model for studying the complexity of GPCR signal transduction mechanisms.

What expression systems are commonly used for producing recombinant guinea pig CALCR?

Several expression systems are available for producing recombinant guinea pig CALCR, each with specific advantages depending on experimental needs:

Expression SystemCharacteristicsApplications
E. coliHigh yield, cost-effective, lacks post-translational modificationsStructural studies, antibody production
YeastModerate yield, some post-translational modificationsFunctional studies requiring basic glycosylation
BaculovirusHigh yield, complex post-translational modificationsSignaling studies, receptor-ligand interactions
Mammalian cellsNative-like post-translational modifications, lower yieldPhysiologically relevant functional studies

Multiple commercial sources offer these expression systems for recombinant guinea pig CALCR, including in vitro E. coli expression systems and partial CALCR expressed in various systems .

What is the tissue distribution of calcitonin receptor in guinea pigs?

The guinea pig calcitonin receptor shows a distinctive tissue distribution pattern. Through a combination of RT-PCR, northern analysis, and expression studies in Xenopus oocytes, research has shown that the guinea pig CALCR is most highly expressed in the diencephalon region of the brain . Unlike some other species that express multiple receptor subtypes, only a single subtype of calcitonin receptor was detected in guinea pig tissues . This unique expression pattern makes guinea pig CALCR valuable for comparative studies examining the relationship between receptor distribution and physiological function across species.

How does the interaction between CALCR and Receptor Activity-Modifying Proteins (RAMPs) alter receptor pharmacology in guinea pig models?

The interaction between calcitonin receptor and Receptor Activity-Modifying Proteins (RAMPs) creates functionally distinct receptor complexes with altered pharmacological properties. In guinea pigs, RAMP2 has been identified as an accessory protein that interacts with and modulates the function of CALCR . This interaction produces significant changes in receptor function:

  • CALCR alone functions as a calcitonin receptor

  • CALCR + RAMP1 forms AMY1 receptor (amylin receptor)

  • CALCR + RAMP2 forms AMY2 receptor

  • CALCR + RAMP3 forms AMY3 receptor

These heterodimeric complexes show distinct ligand binding preferences and signaling properties. For example, while the guinea pig CALCR alone does not respond to physiological concentrations of rat amylin , the formation of AMY receptor complexes can enable amylin responsiveness. RAMP2 is required for the transport of calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane and together they form a receptor complex for adrenomedullin/ADM . With CALCR, RAMP2 acts as a receptor complex for both calcitonin/CT/CALC and amylin/IAPP . This versatility in forming different receptor complexes makes the guinea pig CALCR an excellent model for studying GPCR heterodimer pharmacology.

What methodological approaches are most effective for studying ligand binding kinetics of recombinant guinea pig CALCR?

Studying ligand binding kinetics of recombinant guinea pig CALCR requires specialized methodological approaches:

MethodMeasurementAdvantagesLimitations
Radioligand bindingEquilibrium binding constants (Kd, Bmax), association/dissociation ratesGold standard for quantitative binding parametersRequires radioactive materials, limited throughput
Time-resolved FRETReal-time binding kinetics, receptor conformational changesNo radioactivity, higher throughputRequires fluorescent ligands or antibodies
Surface plasmon resonanceLabel-free binding kineticsProvides kon and koff rates in real-timeRequires purified receptor preparations
Bioluminescence resonance energy transfer (BRET)Receptor-ligand interactions in living cellsAllows study of receptor dimerization and conformational changesRequires genetic modification of receptors

When studying guinea pig CALCR specifically, researchers should note the exceptionally high affinity for salmon calcitonin (EC50 of 0.1 nM) when designing binding experiments, as this may require adjustments to ligand concentrations compared to studies with human CALCR.

What experimental strategies can resolve contradictory findings regarding guinea pig CALCR coupling to different G proteins?

Resolving contradictory findings regarding guinea pig CALCR G protein coupling requires systematic experimental approaches:

  • BRET/FRET-based G protein activation assays: These assays can directly measure activation of specific G protein subtypes (Gs, Gi/o, Gq/11) in response to receptor stimulation, allowing quantitative comparison of coupling efficiencies.

  • Pathway-selective inhibitors: Use of selective inhibitors such as PTX (Gi/o inhibitor), YM-254890 (Gq/11 inhibitor), or PKA inhibitors can help dissect the relative contributions of different G protein pathways.

  • CRISPR-Cas9 G protein knockouts: Generate cell lines with specific G protein subunits knocked out to determine the necessity of each pathway.

  • Biased ligand screening: Test a panel of calcitonin analogs for biased signaling to identify ligands that preferentially activate specific pathways.

  • Receptor mutagenesis: Systematic mutation of intracellular loops and C-terminal domain can identify regions critical for coupling to specific G proteins.

Research has shown that guinea pig CALCR can couple to both cAMP accumulation (EC50 0.1 nM) and phosphatidylinositol hydrolysis (EC50 2.5 nM) , suggesting dual G protein coupling capabilities. Experimental approaches should account for the 25-fold difference in potency between these pathways, as this might be a source of apparent contradictions in the literature.

How do heterologous expression systems affect the functional properties of recombinant guinea pig CALCR?

The choice of heterologous expression system significantly impacts the functional properties of recombinant guinea pig CALCR:

  • Post-translational modifications: Mammalian cells provide more native-like glycosylation and phosphorylation patterns that can affect receptor trafficking, stability, and signaling compared to bacterial or insect cell systems .

  • Membrane composition: Different expression systems have distinct plasma membrane lipid compositions that can affect receptor conformation, lateral mobility, and coupling to effector proteins.

  • G protein complement: Expression systems vary in their endogenous G protein subtype expression levels, potentially masking or enhancing certain signaling pathways.

  • Receptor accessory proteins: The availability of RAMPs and other accessory proteins differs between expression systems, affecting receptor pharmacology. For example, the formation of AMY receptor complexes requires co-expression of both CALCR and appropriate RAMPs .

  • Receptor expression levels: Overexpression can lead to constitutive activity or altered signaling due to non-physiological receptor clustering or depletion of limiting G proteins.

To address these variables, researchers should:

  • Quantify receptor expression levels

  • Characterize the endogenous expression of RAMPs and G proteins in the chosen system

  • Consider co-expression of relevant accessory proteins

  • Compare results across multiple expression systems

What are the optimal conditions for functional assays with recombinant guinea pig CALCR?

Optimizing functional assays for recombinant guinea pig CALCR requires attention to several key parameters:

ParameterRecommendationRationale
Cell density20,000-50,000 cells/well (96-well format)Ensures adequate signal without contact inhibition
Transfection timing24-48 hours pre-assayAllows optimal protein expression and membrane trafficking
Serum starvation4-16 hours pre-assayReduces baseline signaling and increases signal-to-noise ratio
Buffer compositionHBSS with 20 mM HEPES, pH 7.4, 0.1% BSAMaintains cell viability and reduces non-specific binding
Ligand concentration range10⁻¹² to 10⁻⁶ M for salmon calcitonin; 10⁻¹⁰ to 10⁻⁵ M for human calcitoninAccounts for >250-fold potency difference between ligands
Incubation temperature37°CPhysiological optimum for receptor function
Incubation timecAMP: 15-30 min; PI hydrolysis: 30-60 minReflects differing kinetics of signaling pathways

When designing functional assays specifically for guinea pig CALCR, it is critical to account for the high potency of salmon calcitonin (EC50 0.1 nM) compared to human calcitonin (EC50 27.6 nM) . This substantial difference in potency necessitates careful consideration of concentration ranges when comparing ligands.

How can researchers effectively study the CALCR-RAMP interactions in guinea pig models?

Studying CALCR-RAMP interactions in guinea pig models requires specialized techniques:

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged CALCR and RAMPs to pull down protein complexes and confirm physical interaction.

  • Proximity ligation assay (PLA): Detecting protein-protein interactions in situ with high sensitivity and specificity, allowing visualization of CALCR-RAMP complexes in their cellular context.

  • FRET/BRET approaches: Tagging CALCR and RAMPs with compatible fluorescent/luminescent proteins to monitor their interaction in living cells in real-time.

  • Functional complementation: Using split reporter systems (split luciferase, split GFP) where fragments are fused to CALCR and RAMPs, generating signal only when proteins interact.

  • Pharmacological profiling: Comparing the pharmacological properties of cells expressing CALCR alone or with different RAMPs to indirectly assess complex formation.

The guinea pig CALCR forms distinct receptor complexes with different RAMPs, including AMY1, AMY2, and AMY3 receptors . RAMP2 specifically has been shown to interact with CALCR to form receptor complexes for both calcitonin/CT/CALC and amylin/IAPP . Understanding these interactions is crucial as they dramatically alter the pharmacological properties and ligand preferences of the receptor.

What controls and validations are essential when evaluating guinea pig CALCR expression constructs?

When evaluating guinea pig CALCR expression constructs, several essential controls and validations should be implemented:

  • Expression verification:

    • Western blotting with anti-CALCR antibodies

    • Flow cytometry for surface expression

    • Immunofluorescence microscopy for localization

    • qRT-PCR for mRNA expression levels

  • Functional validation:

    • cAMP accumulation assay (EC50 for salmon calcitonin should be ~0.1 nM)

    • Phosphatidylinositol hydrolysis assay (EC50 for salmon calcitonin should be ~2.5 nM)

    • Calcium mobilization assay

  • Pharmacological validation:

    • Dose-response curves with salmon calcitonin (positive control)

    • Dose-response curves with human calcitonin (should be >250-fold less potent)

    • Confirmation that rat αCGRP and rat amylin do not activate the receptor at physiological concentrations

  • Negative controls:

    • Mock-transfected cells

    • Cells expressing non-functional CALCR mutants

    • Competitive antagonist controls

  • System-specific controls:

    • For studies of RAMP interactions, include CALCR-only and RAMP-only conditions

    • For studies in different expression systems, compare signaling profiles across systems

These validations ensure that the recombinant guinea pig CALCR construct exhibits the expected pharmacological and signaling properties documented in the literature.

How does guinea pig CALCR pharmacology compare to CALCR from other species?

Guinea pig CALCR exhibits distinct pharmacological properties compared to CALCR from other species:

SpeciesKey Pharmacological PropertiesNotable Differences
Guinea pig- High affinity for salmon calcitonin (EC50 0.1 nM)
- Low affinity for human calcitonin (EC50 27.6 nM)
- Single receptor subtype detected
- No activation by rat αCGRP or amylin at physiological concentrations
>250-fold selectivity for salmon vs. human calcitonin
Human- Multiple isoforms (C1a/C1b)
- Moderately responsive to both salmon and human calcitonin
- Forms functional amylin receptors with RAMPs
Human receptors show smaller species selectivity between salmon and human calcitonin
Mouse- Similar to human in ligand preferences
- Well-characterized tissue distribution
- Important role in calcium homeostasis
Different brain expression pattern compared to guinea pig
Rabbit- Commercially available as recombinant protein
- Used in comparative receptor studies
Limited published pharmacological characterization

The exceptional selectivity of guinea pig CALCR for salmon calcitonin over human calcitonin (>250-fold) represents one of the most dramatic species differences in calcitonin receptor pharmacology. This makes guinea pig CALCR a valuable model for studying the structural basis of ligand selectivity in GPCRs.

What insights have been gained from guinea pig CALCR research that apply to human calcitonin receptor biology?

Research on guinea pig CALCR has provided several valuable insights applicable to human calcitonin receptor biology:

  • Structural determinants of ligand binding: The dramatic species-selectivity of guinea pig CALCR for salmon calcitonin over human calcitonin has facilitated identification of critical receptor domains and residues involved in ligand recognition.

  • G-protein coupling mechanisms: Guinea pig CALCR couples to both adenylyl cyclase (EC50 0.1 nM) and phosphatidylinositol hydrolysis (EC50 2.5 nM) , demonstrating the receptor's dual coupling capabilities which are also present in human CALCR.

  • RAMP interactions: Studies of guinea pig CALCR-RAMP complexes have illuminated how these accessory proteins modulate receptor pharmacology and trafficking, with direct parallels to human CALCR-RAMP interactions .

  • Neuronal functions: The high expression of CALCR in the guinea pig diencephalon has contributed to understanding of calcitonin receptor functions in the brain, relevant to human neurophysiology and potential therapeutic targets.

  • Social behavior mechanisms: Research using guinea pig models has contributed to understanding how amylin-calcitonin receptor signaling mediates social behavior , potentially providing insights into social affiliation mechanisms in humans.

These comparative insights highlight the value of guinea pig CALCR as a model system for understanding fundamental aspects of calcitonin receptor biology that may be applicable across species.

What are common challenges in expressing functional recombinant guinea pig CALCR and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant guinea pig CALCR:

ChallengePotential Solutions
Low expression levels- Optimize codon usage for the expression system
- Use strong promoters (CMV for mammalian cells)
- Include Kozak sequence for optimal translation
- Consider stable cell line generation instead of transient transfection
Poor membrane trafficking- Include signal peptide sequence
- Co-express RAMPs which facilitate trafficking
- Lower incubation temperature to 30°C to aid folding
- Add chemical chaperones such as 4-phenylbutyrate
Protein aggregation- Use fusion tags to enhance solubility (MBP, SUMO)
- Express in specialized E. coli strains for difficult proteins
- Include detergents appropriate for GPCRs in extraction buffers
Lack of functional activity- Verify sequence integrity and rule out mutations
- Ensure appropriate post-translational modifications
- Confirm expression of necessary G proteins in host system
- Use positive controls (e.g., salmon calcitonin at 10⁻⁹ to 10⁻⁸ M)
Inconsistent results- Standardize cell density and passage number
- Control transfection efficiency using reporter constructs
- Implement rigorous quality control for reagents
- Consider stable isotopic labeling for quantitative comparisons

A particularly effective approach for expressing functional guinea pig CALCR is co-transfection with appropriate RAMPs, as these accessory proteins are required for the transport of certain calcitonin family receptors to the plasma membrane and formation of functional receptor complexes .

How can researchers accurately quantify and characterize the binding properties of recombinant guinea pig CALCR?

Accurate quantification and characterization of guinea pig CALCR binding properties requires specialized methodological approaches:

  • Radioligand binding assays:

    • Saturation binding: Use 125I-salmon calcitonin (high affinity ligand) at concentrations ranging from 1 pM to 2 nM

    • Competition binding: Displace labeled salmon calcitonin with unlabeled ligands

    • Kinetic studies: Measure association and dissociation rates

  • Non-radioactive alternatives:

    • Fluorescently labeled calcitonin derivatives

    • Time-resolved FRET using lanthanide-labeled ligands

    • Surface plasmon resonance with purified receptor preparations

  • Key parameters to determine:

    • Kd: Should be in the picomolar range for salmon calcitonin

    • Bmax: Receptor density (pmol/mg protein)

    • ki: Inhibition constants for various ligands

    • kon and koff: Association and dissociation rate constants

  • Important considerations:

    • Account for the >250-fold difference in affinity between salmon and human calcitonin

    • Include appropriate non-specific binding controls

    • Consider the impact of RAMP co-expression on binding parameters

    • Validate binding site integrity with known antagonists

For the guinea pig CALCR specifically, researchers should be aware that rat αCGRP and rat amylin do not activate the receptor at physiological concentrations , providing useful negative controls for binding specificity.

What are promising new approaches for studying guinea pig CALCR function in complex tissues?

Emerging technologies offer new approaches to study guinea pig CALCR function in complex tissues:

  • Single-cell RNA sequencing:

    • Identifies cells expressing CALCR within heterogeneous tissues

    • Enables correlation of CALCR expression with other genes

    • Particularly valuable for brain tissues where CALCR shows high expression in the diencephalon

  • CRISPR-Cas9 genome editing in guinea pig models:

    • Introduces specific mutations to study structure-function relationships

    • Creates conditional knockout models for tissue-specific CALCR deletion

    • Facilitates knock-in of reporter tags for in vivo visualization

  • Spatial transcriptomics:

    • Maps CALCR expression within intact tissue architecture

    • Correlates receptor distribution with functional domains

  • Optogenetic and chemogenetic approaches:

    • Controls CALCR-expressing neurons in brain regions

    • Particularly relevant for studying amylin-calcitonin receptor signaling in the medial preoptic area related to social behavior

  • Cryo-EM studies:

    • Determines structural configurations of guinea pig CALCR alone or in complex with RAMPs

    • Provides insight into the structural basis for the receptor's unique pharmacological properties

These approaches will help address fundamental questions about the physiological roles of CALCR in guinea pig tissues, particularly in the brain where the receptor shows distinctive expression patterns.

How might structural biology advances improve our understanding of guinea pig CALCR-ligand interactions?

Structural biology advances offer transformative potential for understanding guinea pig CALCR-ligand interactions:

  • Cryo-electron microscopy (Cryo-EM):

    • Can resolve structures of CALCR in various conformational states

    • Capable of visualizing CALCR-RAMP complexes

    • May explain the >250-fold selectivity for salmon calcitonin over human calcitonin

  • X-ray crystallography:

    • Provides high-resolution structures of the receptor binding domain

    • Can capture ligand-receptor complexes with engineered stabilizing mutations

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps conformational changes upon ligand binding

    • Identifies regions with altered solvent accessibility in different functional states

  • Molecular dynamics simulations:

    • Models the dynamic behavior of guinea pig CALCR with different ligands

    • Predicts binding energetics and key interaction residues

    • Can simulate the effect of RAMP association on receptor conformation

  • NMR spectroscopy:

    • Characterizes ligand binding in solution

    • Studies the dynamics of receptor-ligand interactions

These techniques could reveal the structural basis for the guinea pig CALCR's unique pharmacological profile, particularly its exceptional selectivity for salmon calcitonin and its ability to couple to both adenylyl cyclase and phosphatidylinositol hydrolysis pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.