Recombinant Guinea pig Cholecystokinin receptor type A (CCKAR)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene structure:

  • Encoded by the CCKAR gene (NCBI GeneID: 886) located at chromosomal position 4p15.2 in humans, with guinea pig orthologs showing 89% amino acid homology to rat sequences .

  • Comprises seven transmembrane domains, characteristic of Class A GPCRs, with conserved motifs:

    • E/DRY motif in transmembrane domain III (critical for Gαq coupling)

    • NPXXY motif in transmembrane domain VII (regulates receptor activation) .

Recombinant production:

  • Expressed in Escherichia coli systems with N-terminal His-tags for purification .

  • Detected molecular weight: ~48-52 kDa (varies by glycosylation status) .

Functional Properties

Ligand interactions:

ParameterValueSource
Affinity for CCK-8Kd=0.11.8nMK_d = 0.1-1.8 \, \text{nM}
Selectivity1,000-fold preference for CCK over gastrin

Signaling pathways:

  • Activates phospholipase C (PLC) via Gαq, increasing intracellular calcium ([Ca2+]i[Ca^{2+}]_i) .

  • Modulates feeding behavior and dopamine-dependent neural circuits .

Tissue distribution:

  • Highly expressed in guinea pig gallbladder, pancreas, and gastrointestinal smooth muscle .

  • Low expression in brain regions regulating satiety and anxiety .

Research Applications

Diagnostic tools:

  • Used in ELISA kits (e.g., MBS7249803, GPDL00005) for detecting native CCKAR in biological samples:

Kit ParameterSpecification
Detection range0.156–10 ng/mL
Sensitivity0.078 ng/mL
Sample typesSerum, plasma, tissue homogenates

Therapeutic studies:

  • Linked to gallbladder cancer susceptibility in women through genetic variant analyses .

  • Targeted in drug development for obesity and pancreatitis due to its role in appetite regulation .

Experimental Validation

  • Binding assays: Radiolabeled CCK-8 shows saturable binding to recombinant CCKAR with Bmax=1,200fmol/mg proteinB_{\text{max}} = 1,200 \, \text{fmol/mg protein} in transfected CHO cells .

  • Confocal microscopy: Confirmed colocalization with c-kit⁺ interstitial cells in guinea pig biliary ducts, implicating CCKAR in smooth muscle motility .

Comparative Species Analysis

SpeciesAmino Acid Identity vs. Guinea PigKey Functional Divergence
Human89%Altered gallbladder expression patterns
Cynomolgus monkey93%Identical ligand affinity profiles
Rat89%Differential pancreatic receptor density

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CCKAR; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MDVVDSLFVNGSNITSACELGFENETLFCLDRPRPSKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPSLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTGNMCRFLLPNDVMQQTWHTFLLLILFLIPGIVMMVAYGLISLELYQGI KFDAIQKKSAKERKTSTGSSGPMEDSDGCYLQKSRHPRKLELRQLSPSSSGSNRINRIRS SSSTANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAERHLSGTPISFILLL SYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGTPGVRGEMGEEEEGRTTGASLSRYSY SHMSTSAPPP
Uniprot No.

Target Background

Function
Cholecystokinin receptor type A (CCKAR) is a receptor for cholecystokinin. It mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gallbladder and stomach. CCKAR exhibits a 1000-fold higher affinity for CCK compared to gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by associating with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Sphincter of Oddi CCKAR expression levels were found to be elevated in the cholesterol gallstone groups compared to the control group. PMID: 27350732
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Cholecystokinin A Receptor (CCKAR) and what are its primary functions?

The Cholecystokinin A Receptor (CCKAR, also known as CCK1, CCKRA, or CCK1R) is a G-protein coupled receptor that serves as the primary binding site for the peptide hormone and neurotransmitter cholecystokinin (CCK). CCKAR plays crucial roles in multiple physiological systems, with particularly significant functions in:

  • Regulation of gastrointestinal functions, including digestion and gastric emptying

  • Control of appetite and food intake behaviors

  • Gallbladder contraction and bile secretion

  • Pancreatic enzyme release

Research methodologies for studying CCKAR function typically include receptor binding assays, functional activity measurements in isolated tissues, and in vivo studies using receptor-specific agonists and antagonists. The receptor's activity can be reliably measured using techniques such as calcium mobilization assays, cAMP accumulation tests, and electrical activity recording in tissues expressing the receptor .

How does CCKAR differ from CCKBR in expression patterns and physiological roles?

CCKAR and CCKBR (the other known CCK receptor subtype) display distinct and often complementary expression patterns and functions:

CharacteristicCCKARCCKBR
Primary expressionPredominantly in peripheral tissues (pancreas, gallbladder, GI tract)Predominantly in central nervous system
Developmental patternDynamic expression during embryonic and postnatal developmentLargely reciprocal expression pattern to CCKAR during development
Role in feedingMediates inhibition of food intake in response to CCKMinimal role in acute feeding inhibition
Binding affinityHigher affinity for sulfated CCKBinds both CCK and gastrin with similar affinity

Methodologically, researchers can distinguish between these receptors using subtype-selective agonists and antagonists, with L-364,718 being a commonly used CCKAR-specific antagonist. Knockout models lacking either receptor have been developed to study their distinct functions. Notably, studies have demonstrated that intraperitoneal administration of CCK fails to decrease food intake in mice lacking CCKAR, while the same treatment reduces food intake by up to 90% in wild-type and CCKBR knockout mice .

What detection methods are available for measuring CCKAR in guinea pig samples?

Several methodologies are available for detecting and quantifying CCKAR in guinea pig samples:

  • ELISA (Enzyme-Linked Immunosorbent Assay): Sandwich ELISA kits offer high sensitivity (down to 0.078 ng/mL) with detection ranges of approximately 0.156-10 ng/mL. These kits are optimized for guinea pig serum, plasma, tissue homogenates, and other biological fluids .

  • Immunohistochemistry (IHC): Allows visualization of CCKAR distribution in tissue sections using specific antibodies.

  • RT-PCR and qPCR: Enables detection and quantification of CCKAR mRNA expression.

  • Western Blotting: Provides protein-level detection with molecular weight confirmation.

For optimal results when using ELISA, samples should be carefully prepared according to kit instructions, with attention to avoiding freeze-thaw cycles. Standard curves should be prepared with each assay run, and appropriate controls included. Most commercial kits use a colorimetric detection system with a primary wavelength of 450 nm .

How do CCKAR and CCKBR functionally interact in brain development, and what are the implications for neurological research?

Recent research has uncovered a previously unappreciated developmental role for CCK receptors in mammalian neocortical development. Studies using compound homozygous mutant mice lacking both CCKAR and CCKBR activity have revealed:

  • Synergistic Effects: The two receptors demonstrate additive, functionally synergistic effects in brain development.

  • Cortical Development Abnormalities: Combined receptor loss leads to:

    • Defects in midline formation

    • Corpus callosum abnormalities

    • Cortical interneuron migration disturbances

  • Dynamic Expression Patterns: CCKAR and CCKBR exhibit largely reciprocal expression patterns during embryonic and postnatal brain development.

Methodologically, researchers investigating these interactions should consider comparative transcriptome analysis of embryonic neocortex as a powerful approach to define the molecular mechanisms underlying developmental defects. This can be accomplished through RNA sequencing of tissue samples from wild-type and receptor knockout models, followed by pathway analysis of differentially expressed genes .

The implications extend to understanding neurodevelopmental disorders characterized by corpus callosum abnormalities and cortical migration defects. The research suggests that targeting CCK receptor systems might offer therapeutic approaches for certain neurodevelopmental conditions.

What role does CCKAR play in gallbladder motility and acute cholecystitis pathophysiology?

CCKAR appears to be integrally involved in gallbladder motility and the pathophysiology of acute cholecystitis (AC):

  • Normal Physiology: CCKAR mediates CCK-induced gallbladder contractions and is expressed in gallbladder smooth muscle cells.

  • Relationship with Interstitial Cells of Cajal (ICCs): ICCs generate slow waves (SW) that regulate gallbladder contractions. CCKAR expression appears to be functionally related to ICC activity.

  • Pathophysiological Changes: In acute cholecystitis:

    • Impaired ICC function is central to the pathophysiology

    • CCKAR expression levels change during disease progression

    • These changes correlate with decreased gallbladder contractility

Research approaches to study this relationship include:

  • In vivo and in vitro motility studies in guinea pig models

  • Measurement of CCKAR protein expression via Western blotting

  • Assessment of related proteins (c-Kit, α-SMA, connexin 43) that interact with CCKAR in gallbladder function

  • Common bile duct ligation as an experimental model to induce AC and study associated changes

For researchers investigating gallbladder motility disorders, examining the relationship between CCKAR, ICCs, and connexin 43 expression provides valuable insights into the molecular mechanisms of gallbladder dysfunction .

How does genetic deletion of CCKAR affect long-term body weight regulation, despite its role in acute feeding inhibition?

A fascinating paradox in CCKAR research is the disparity between its clear role in acute feeding inhibition and its less obvious impact on long-term body weight regulation:

  • Acute Effects: CCKAR knockout mice show complete resistance to CCK-induced feeding inhibition, confirming the receptor's essential role in mediating CCK's satiety effects.

  • Long-term Outcomes: Despite this acute effect, CCKAR -/- mice maintain normal body weight well into adult life, similar to wild-type mice.

  • Contrast with OLETF Rats: This finding contrasts with observations in Otsuka Long-Evans Tokushima Fatty (OLETF) rats, which lack functional CCKAR due to a spontaneous gene deletion and develop obesity with aging.

Methodological considerations for studying this phenomenon include:

  • Long-term monitoring of food intake across light and dark cycles

  • Measuring food intake in different feeding paradigms (free-feeding vs. scheduled feeding)

  • Comparing body weight curves between knockout and wild-type animals over extended periods

  • Detailed metabolic phenotyping (energy expenditure, respiratory quotient, activity levels)

  • Evaluating compensatory mechanisms that might emerge in CCKAR-deficient animals

Current evidence suggests that while CCKAR mediates the acute response to CCK administration, redundant or compensatory mechanisms likely maintain long-term energy homeostasis in its absence. This presents an important research area for scientists interested in energy balance regulation and potential therapeutic targets for metabolic disorders .

What are the optimal sample preparation techniques for CCKAR detection in guinea pig tissue homogenates?

Effective sample preparation is crucial for accurate CCKAR detection in guinea pig tissues:

  • Tissue Collection and Storage:

    • Harvest tissues rapidly after euthanasia to minimize protein degradation

    • Flash-freeze samples in liquid nitrogen and store at -80°C until processing

    • Avoid repeated freeze-thaw cycles which can degrade receptor proteins

  • Homogenization Protocol:

    • Use ice-cold PBS (pH 7.2-7.4) containing protease inhibitors

    • Mechanical disruption should be performed on ice using a tissue homogenizer

    • Use brief pulses (10-15 seconds) with cooling intervals to prevent protein denaturation

    • Aim for a final tissue:buffer ratio of approximately 1:5 to 1:10 (w/v)

  • Clarification Steps:

    • Centrifuge homogenates at 5000×g for 5-10 minutes at 4°C

    • Collect supernatant while avoiding the lipid layer (if present)

    • For membrane preparations, additional ultracentrifugation steps may be required

  • Sample Quantification:

    • Determine protein concentration using Bradford or BCA assay

    • Standardize all samples to the same protein concentration

    • For ELISA, prepare multiple dilutions to ensure readings fall within the assay's dynamic range (0.156-10 ng/mL for most commercial kits)

When using commercial ELISA kits, samples must be adequately diluted to avoid matrix interference effects. Recovery tests using spiked standards can help verify proper sample preparation and identify potential interfering substances .

How should researchers interpret contradictory data between CCKAR expression levels and functional responses in experimental models?

Contradictory findings between CCKAR expression and functional responses are not uncommon in research. A systematic approach to resolving such discrepancies includes:

  • Receptor Expression vs. Functionality Assessment:

    • Protein expression levels (detected by ELISA/Western blot) may not correlate directly with receptor functionality

    • Post-translational modifications can affect receptor activity without changing expression levels

    • Receptor internalization and trafficking dynamics may explain divergent results

  • Signaling Pathway Considerations:

    • Examine downstream signaling components that might be differentially regulated

    • Assess G-protein coupling efficiency and specificity

    • Consider potential cross-talk with other receptor systems

  • Experimental Design Analysis:

    • Evaluate the timing of measurements (acute vs. chronic effects)

    • Consider differences in experimental models (in vitro cell lines vs. ex vivo tissue preparations vs. in vivo models)

    • Assess the specificity of pharmacological tools used (potential off-target effects)

  • Technical Approach to Resolving Discrepancies:

    • Combine multiple techniques to assess receptor function (binding assays, signaling assays, and physiological responses)

    • Use genetic approaches (siRNA knockdown or CRISPR-based editing) to validate pharmacological findings

    • Perform time-course studies to capture dynamic changes in receptor expression and function

Data from receptor knockout studies can be particularly valuable in resolving contradictions, as complete absence of receptor response provides a definitive negative control. When comparing contradictory literature findings, careful attention should be paid to methodology differences and model systems used .

What are the key considerations when designing experiments to study CCKAR-CCKBR interactions in developmental contexts?

When investigating the developmental interactions between CCKAR and CCKBR, researchers should consider these methodological approaches:

  • Temporal Resolution:

    • Design experiments to capture distinct developmental stages (embryonic, early postnatal, juvenile, adult)

    • Consider the dynamic and reciprocal expression patterns of these receptors during development

    • Create developmental timelines documenting receptor expression changes

  • Spatial Considerations:

    • Use region-specific analyses to account for differential expression across brain regions

    • Consider cell-type specific expression patterns (neurons vs. glia)

    • Employ techniques like laser capture microdissection for precise regional analysis

  • Genetic Models:

    • Compare single receptor knockouts (CCKAR-/- or CCKBR-/-) with compound knockouts

    • Consider conditional knockout models for temporal and spatial specificity

    • Use reporter lines to visualize receptor expression patterns

  • Functional Assessment Tools:

    • Combine structural analysis (immunohistochemistry, in situ hybridization) with functional assays

    • Use electrophysiological approaches to assess neuronal activity

    • Employ behavioral testing relevant to the circuits being studied

    • Consider transcriptome analysis to identify molecular pathways affected by receptor deletion

  • Data Integration Approach:

    • Create comprehensive datasets that integrate expression, structure, and function

    • Use computational approaches to model receptor interactions

    • Consider pathway analysis to identify common downstream targets

When studying functional synergy between receptors, it's essential to design experiments that can distinguish between additive, synergistic, and redundant effects. This typically requires careful dose-response studies and mathematical modeling of interaction effects .

What are common pitfalls in CCKAR ELISA assays and how can researchers improve assay reliability?

Researchers frequently encounter these challenges when performing CCKAR ELISA assays:

  • High Background Signal Issues:

    • Cause: Insufficient washing, contaminated washing buffer, or non-specific binding

    • Solution: Increase washing steps, prepare fresh buffers, optimize blocking conditions, or verify antibody specificity

  • Poor Standard Curve Linearity:

    • Cause: Improper standard reconstitution, pipetting errors, or degraded standards

    • Solution: Carefully follow reconstitution protocols, use calibrated pipettes, prepare fresh standards for each assay

  • Sample Matrix Interference:

    • Cause: Components in biological samples interfering with antibody binding

    • Solution: Dilute samples appropriately, perform spike-recovery tests, or use sample-specific optimization

  • Low Detection Sensitivity:

    • Cause: Suboptimal antibody binding, inappropriate detection system

    • Solution: Optimize incubation conditions (time, temperature), select kits with appropriate sensitivity range (0.078 ng/mL detection limit for most CCKAR kits)

  • Inter-Assay Variability:

    • Cause: Inconsistent technique, temperature fluctuations, or reagent degradation

    • Solution: Standardize protocols, include control samples across assays, perform technical replicates

To improve assay reliability, researchers should:

  • Prepare a complete standard curve (0.156-10 ng/mL) with each assay

  • Include both positive and negative controls in every experiment

  • Store kit components as directed (typically TMB substrate, wash buffer at 4°C and other items at -20°C)

  • Process all samples identically and within a single assay when possible

  • Validate results with complementary techniques when introducing new sample types

How can researchers effectively distinguish between direct CCKAR effects and indirect effects mediated through other signaling pathways?

Distinguishing direct CCKAR effects from indirect pathway effects requires a multi-faceted experimental approach:

  • Pharmacological Dissection Strategy:

    • Use highly selective CCKAR antagonists (like L-364,718) to block specific receptor activity

    • Compare effects of CCK peptide variants with differential receptor selectivity

    • Employ time-course studies to separate rapid (likely direct) from delayed (possibly indirect) effects

  • Genetic Manipulation Approaches:

    • Utilize CCKAR knockout models as definitive negative controls

    • Compare with CCKBR knockouts to distinguish receptor-specific effects

    • Consider inducible or conditional knockout systems for temporal control

  • In Vitro Cell Systems:

    • Use cell lines expressing only CCKAR without other related receptors

    • Perform receptor transfection studies in null backgrounds

    • Compare responses in systems with and without potential interacting partners

  • Signaling Pathway Analysis:

    • Examine activation kinetics of downstream signaling molecules

    • Use inhibitors of specific signaling pathways to block potential indirect mechanisms

    • Monitor multiple endpoints simultaneously to capture pathway divergence

  • Detailed Controls and Validations:

    • Include controls for non-specific effects of all compounds used

    • Verify receptor expression levels before interpreting functional data

    • Consider dose-response relationships (direct effects typically show clear concentration-dependence)

The gold standard approach combines pharmacological and genetic strategies. For example, a response that is blocked by a CCKAR-selective antagonist and absent in CCKAR knockout animals, but preserved in CCKBR knockout animals, can be confidently attributed to direct CCKAR activation .

What strategies can overcome the challenges of studying CCKAR in guinea pig models compared to more commonly used rodent species?

Working with guinea pig models presents unique challenges compared to mouse or rat models, requiring specific methodological adaptations:

  • Genetic Manipulation Limitations:

    • Challenge: Fewer genetic tools available for guinea pigs

    • Strategy: Utilize pharmacological approaches with receptor-specific compounds
      - Consider viral vector delivery systems for localized genetic manipulation
      - Use CRISPR/Cas9 technology adapted for guinea pig cells

  • Antibody Availability Issues:

    • Challenge: Fewer validated antibodies for guinea pig proteins

    • Strategy: Test cross-reactivity of antibodies raised against conserved regions
      - Develop custom antibodies using guinea pig-specific sequences
      - Validate antibodies using multiple techniques and appropriate controls

  • Sample Collection Optimization:

    • Challenge: Anatomical differences affecting tissue collection

    • Strategy: Adapt dissection protocols specifically for guinea pig anatomy
      - Optimize perfusion techniques for guinea pig vasculature
      - Consider species-specific differences in tissue preservation requirements

  • Housing and Handling Considerations:

    • Challenge: Different husbandry requirements and handling sensitivity

    • Strategy: Allow extended acclimation periods before experiments
      - Optimize housing conditions to reduce stress
      - Use consistent handling techniques to minimize variability

  • Experimental Design Adaptations:

    • Challenge: Physiological differences affecting experimental outcomes

    • Strategy: Include appropriate guinea pig-specific controls
      - Account for species differences in drug metabolism and pharmacokinetics
      - Adjust dosing based on guinea pig-specific body weight and distribution

When studying gallbladder function specifically, guinea pigs offer advantages as their gallbladder physiology more closely resembles humans than do mice or rats. For these studies, common bile duct ligation serves as an effective model for acute cholecystitis, allowing investigation of CCKAR's role in gallbladder motility and inflammation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.