Recombinant Guinea pig cytomegalovirus Envelope glycoprotein H (gH)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Guinea Pig Cytomegalovirus Envelope Glycoprotein H (gH)

Recombinant Guinea pig cytomegalovirus Envelope glycoprotein H (gH) is a protein component studied within the context of the guinea pig cytomegalovirus (GPCMV) model, which serves as an important tool for understanding congenital cytomegalovirus (CMV) infections . Specifically, GPCMV gH is investigated for its role in viral entry and its potential as a target for vaccine development . Glycoprotein H is part of a pentameric complex (PC), that includes gH, gL, GP129, GP131, and GP133 .

Role in Vaccine Development

Given the significance of the pentameric complex in viral infection, GPCMV proteins, including gH, are being explored as potential vaccine targets . Recombinant forms of these proteins have been generated to assess their immunogenicity and protective capabilities .

  • Immunogenicity: Studies have confirmed that recombinant GPCMV proteins, including gH, elicit an immune response in infected animals, suggesting their potential as vaccine candidates .

  • Protective Efficacy: Vaccines that include the pentameric complex have shown promise in reducing vertical transmission of the virus, highlighting the importance of gH and its associated proteins in eliciting protective immunity .

Research Findings

Research has focused on understanding the function and immunogenicity of gH and its related proteins within the pentameric complex.

  • Expression and Detection: Mass spectrometry and Western blot assays have confirmed the presence of GP129, GP131, and GP133 proteins in virus particles, indicating that these proteins, along with gH and gL, are integral components of the GPCMV virion .

  • Immune Response: Recombinant proteins corresponding to the PC proteins were immunoreactive with convalescent sera from infected animals, suggesting that these proteins are recognized in the humoral immune response to GPCMV infection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
gH; UL75; Envelope glycoprotein H; gH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-723
Protein Length
Full Length of Mature Protein
Species
Guinea pig cytomegalovirus (strain 22122) (GPCMV)
Target Names
gH
Target Protein Sequence
SSWFDPFIEWARSSPNMTCVNNRTGTRSLATEGLISFNFYEASRTVRTYQVPKCIFMSSV SKTIMQGVDLFESLESYRRRYYSYIIVPVHASFQIFIHDLRTDLSSPTEELTSPVDKTLP NVTIWHTPSGYVIRLLDVVTPRFEECTLFPNHTVIFDMTVPCSQEVYLRQTGKHQFAIVL TFTPSFFVLNIQTAQHQHVTENDEDVILIFGDVRSIDVKAPYSKPVLTLRQSYRDDLLIV AKTSIVNATYPFIKTQDFLKGTLSGNYLDFNHVYTEFNRLVIHNLVEGLCDAPPDDRTVS MVFSYAVLARTLYHTSNVTARLEDVALRYVRLTLARTFLQQCFDVGPRYMRFPTIDGALS VLLKLIRNSRDVDGGLKLSLTFALIFGNNTDMTKERDLENALYEMKSIHRAGLVSPLSPR QRSLLYMMAYVTHHTTAFPDIRREMLAMQTSLCSPQELYNWAPHVSSAGLTMQEMFTPCS GSGRRDYSEARIAEIVQLNPLTTKTPADLYRILAHFDRSNLTNFPALSCISHLSGYVAVT LRDVTYVVSSNVMLKGTSYPVTNLAVDKTMIVTVSPAQHPCEKTEVAHATRSIPIVKNIT IGNDCEYCKSAIMEYDEVNGLSNIVYLADTADLVLVTNLDNRILASSPRTRYIMMTANGT LMEITSVIIDIRQTSIFMIMLYCSLGVLLLYGLYRLLHMI
Uniprot No.

Target Background

Function

The heterodimeric glycoprotein H-glycoprotein L complex is crucial for the fusion of viral and host cell plasma membranes, enabling viral entry. Following initial receptor binding, membrane fusion is facilitated by the fusion machinery comprising gB and the gH/gL heterodimer. This complex may also participate in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.

Database Links

KEGG: vg:14536668

Protein Families
Herpesviridae glycoprotein H family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein.

Q&A

What is Guinea pig cytomegalovirus (GPCMV) glycoprotein H (gH) and why is it important for research?

GPCMV gH is a critical envelope glycoprotein that forms part of the core fusion machinery required for viral entry into host cells. The importance of GPCMV gH stems from its role in the guinea pig model of congenital cytomegalovirus (CMV) infection, which is the only small animal model for studying congenital CMV transmission. GPCMV gH forms homologous glycoprotein complexes to human CMV (HCMV), including the gH-based trimer (gH/gL/gO) and pentamer complex (gH/gL/GP129/GP131/GP133) . These similarities make GPCMV a valuable translational model, particularly for testing CMV intervention strategies in humans, including vaccines against congenital CMV infection .

How does GPCMV gH compare structurally and functionally to human CMV gH?

GPCMV gH shares sequence and positional homology with HCMV gH. Like HCMV, GPCMV gH forms part of the core fusion machinery essential for viral entry. Both form similar complex structures:

Complex TypeHCMV ComponentsGPCMV ComponentsFunction
TrimergH/gL/gOgH/gL/gORequired for infection of fibroblasts
PentamergH/gL/UL128/UL130/UL131AgH/gL/GP129/GP131/GP133Required for infection of epithelial, endothelial cells, and placental cells

The GPCMV gL ORF encodes a protein of 258 amino acids with 6 cysteine residues and contains 3 potential N-linked glycosylation sites, with a predicted molecular weight of 29.7 kDa . Similar to HCMV, stability and cell surface expression of GPCMV gH is enhanced by co-expression with gL .

What are the most effective methods for producing recombinant GPCMV gH for research purposes?

Based on the research literature, several approaches have been successfully used to produce recombinant GPCMV gH:

  • Mammalian Expression Systems: Cell lines such as U373 have been used to stably express gH and gL proteins. This approach allows for proper folding and post-translational modifications of the glycoproteins .

  • Co-expression with gL: Since gL stabilizes gH by limiting its degradation by the proteasome, co-expression of both proteins is recommended for optimal production and cell-surface expression of gH .

  • Bacterial Expression Systems: For specific applications, portions of gH can be expressed as fusion proteins (e.g., with glutathione-S-transferase) in E. coli using systems like pGEX .

  • Viral Vector Systems: Recombinant viruses or bacterial artificial chromosome (BAC) clones can be used to express gH in the context of other viral proteins .

When designing expression constructs, it's important to consider including appropriate tags for purification and detection, and potentially adding a trimerization domain like T4 fibritin (foldon) to stabilize the protein structure .

How can researchers evaluate the quality and activity of recombinant GPCMV gH?

Multiple complementary approaches should be used to assess recombinant GPCMV gH:

  • Biochemical Characterization:

    • SDS-PAGE and Western blotting to confirm molecular weight (~40 kDa for the mature glycoprotein)

    • Glycosylation analysis to verify proper post-translational modifications

    • Pulse-chase experiments to analyze formation of gH/gL complexes

  • Functional Assays:

    • Cell-cell fusion assays: Expression of gpPDGFRA and gH/gL/gO in adjacent cells enables cell fusion

    • Binding assays: Immunoprecipitation to demonstrate direct interaction with receptors like gpPDGFRA

    • Neutralization assays: Testing whether antibodies raised against the recombinant protein can neutralize GPCMV infection

  • Structural Integrity:

    • Flow cytometry to assess surface expression when expressed in cells

    • Conformational antibody binding to verify proper folding

What glycoprotein complexes does GPCMV gH form and how are they best studied?

GPCMV gH forms at least two major glycoprotein complexes:

  • Trimer Complex (gH/gL/gO):

    • Required for infection of fibroblasts

    • Interacts with platelet-derived growth factor receptor alpha (gpPDGFRA)

    • Can be studied through co-immunoprecipitation assays to demonstrate direct interaction with gpPDGFRA

  • Pentamer Complex (gH/gL/GP129/GP131/GP133):

    • Required for infection of epithelial, endothelial, and placental cells

    • Important for viral dissemination and pathogenesis

    • Can be studied through co-expression experiments followed by immunoprecipitation

Research suggests that a third complex, gB/gH/gL, may also exist in GPCMV as it does in HCMV, where up to 50% of gH/gL binds to gB in the virion envelope .

To study these complexes, researchers typically use:

  • Co-transfection of cells with plasmids encoding the individual components

  • Immunoprecipitation assays to isolate complexes

  • Western blotting to detect associated proteins

  • Cell-cell fusion assays to assess functional activity

  • CRISPR/Cas9 to evaluate receptor requirements

How does GPCMV gH interact with cellular receptors and what methods are best to study these interactions?

GPCMV gH, as part of different complexes, interacts with different cellular receptors:

  • gH/gL/gO Trimer: Interacts with gpPDGFRA on fibroblast cells. Immunoprecipitation assays have demonstrated direct interaction of gH/gL/gO with gpPDGFRA but not in the absence of gO .

  • gH/gL/GP129/GP131/GP133 Pentamer: Required for infection of cells lacking PDGFRA, such as epithelial and endothelial cells. Similar to HCMV, the pentamer likely interacts with receptors like neuropilin-2 (NRP2) .

Methodologies to study these interactions include:

  • Receptor Identification: CRISPR/Cas9 screening to identify putative receptors (as done for gpPDGFRA)

  • Binding Assays: Surface plasmon resonance or ELISA to measure binding kinetics

  • Co-immunoprecipitation: To confirm physical interactions between complexes and receptors

  • Cell Entry Assays: Transient expression of receptors in non-susceptible cell lines to confirm functionality

  • Mutagenesis: Introduction of specific mutations (e.g., N-linked glycosylation site mutations, tyrosine kinase domain mutations) to assess their impact on receptor binding and entry

What is the potential of recombinant GPCMV gH as a vaccine component against congenital CMV?

Recombinant GPCMV gH shows significant promise as a vaccine component, particularly when combined with other glycoproteins:

  • Synergistic Neutralizing Activity: Immunization with gB in combination with gH/gL can induce strong synergistic neutralizing activities against CMV . Research shows that this combination can elicit up to 17-fold higher CMV neutralizing activities compared to the sum of neutralizing activity elicited by the individual proteins .

  • Broad Protection: The combination of core fusion machinery envelope proteins (gB+gH/gL) or the combination of gB and pentameric complex could be ideal vaccine candidates that induce optimal immune responses against CMV infection .

  • Protection Against Congenital Transmission: Studies have demonstrated that anti-GPCMV gH/gL neutralizing monoclonal antibodies protect against fetal infection and loss in the guinea pig model , supporting the inclusion of gH in CMV vaccine formulations.

  • Enhanced Protection with Pentamer Components: Including all components of the pentamer complex (gH/gL/GP129/GP131/GP133) in a vaccine formulation may further enhance protection, especially against infection of epithelial and endothelial cells .

How do neutralizing antibodies against GPCMV gH function, and what methods are best to evaluate their efficacy?

Neutralizing antibodies against GPCMV gH function through several mechanisms:

  • Blocking Receptor Binding: Antibodies may prevent the interaction between gH-containing complexes and cellular receptors like PDGFRA or NRP2.

  • Preventing Fusion: Antibodies can interfere with the conformational changes in the core fusion machinery that are necessary for membrane fusion.

  • Complex-Specific Neutralization: Antibodies targeting different gH complexes (trimer vs. pentamer) may confer different patterns of protection. Anti-pentamer antibodies are particularly important for preventing infection of epithelial and endothelial cells .

Methods to evaluate neutralizing antibody efficacy include:

  • In Vitro Neutralization Assays: Using different cell types (fibroblasts, epithelial cells, endothelial cells) to assess neutralization breadth. A comparison study showed anti-gB sera neutralized fibroblast infection but was less effective on placental amniotic sac epithelial (GPASE) cells and renal epithelial cells compared to sera containing antibodies to the pentamer complex .

  • Animal Model Studies: The guinea pig model allows evaluation of protection against maternal-fetal transmission. Studies have shown that anti-gH/gL monoclonal antibodies can protect against congenital infection and fetal loss .

  • Cell-Type Specific Protection: Testing neutralization on various cell types is critical, as studies show that anti-gB sera has limited ability to neutralize GPCMV on non-fibroblast cells despite the essential nature of gB glycoprotein .

How can recombinant GPCMV gH be used to study viral tropism and cell-type specific infection?

Recombinant GPCMV gH is a valuable tool for studying viral tropism and cell-type specific infection through several approaches:

  • Cell Receptor Engineering: Expression of recombinant gH (as part of trimer or pentamer) in conjunction with cell lines expressing different receptors can help delineate the molecular requirements for viral entry into specific cell types .

  • Tropism Studies: Research has revealed that GPCMV requires the pentamer complex (including gH) for infection of epithelial and endothelial cells that lack PDGFRA expression, while trimer-mediated entry via PDGFRA occurs in fibroblasts . This mirrors HCMV tropism patterns, making it a valuable translational model.

  • Viral Mutants: Creation of GPCMV variants with mutations in gH can help identify domains crucial for infection of specific cell types. For example, studies have shown that the D138A alteration in GP131 (a pentamer component) enhances viral infection by an additional 10-fold .

  • Placental and Congenital Infection: GPCMV gH-containing complexes are critical for studying placental infection mechanisms. Research found that the placental response to GPCMV depends on timing of infection, with viral loads quantified by ddPCR in placentas and fetal membranes .

  • Endothelial Cell Infection: GPCMV endothelial cell infection depends on the pentamer complex, with studies showing that infection is either lytic or persistent depending on tissue origin . This has implications for viral dissemination and congenital disease.

What are the current challenges and advanced techniques in studying GPCMV gH structure-function relationships?

Research on GPCMV gH structure-function relationships faces several challenges and has employed advanced techniques:

  • Stabilization for Structural Studies: Similar to HCMV, structural studies of prefusion GPCMV gH likely require stabilization strategies. Techniques may include:

    • Disulfide bond engineering

    • Cavity-filling mutations

    • Proline substitutions at key positions

    • Fusion with stabilizing domains like T4 fibritin (foldon)

  • Complex Formation Analysis: Advanced techniques for studying gH-containing complex formation include:

    • Pulse-chase experiments with metabolic labeling to track complex assembly

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Cryo-electron microscopy for structural determination

    • Surface plasmon resonance to measure binding kinetics

  • Receptor Binding Analysis: Challenges in understanding the receptor interactions include:

    • Multiple receptor candidates for pentamer binding (similar to HCMV)

    • Cell-type specific expression patterns of receptors

    • Possible redundancy in entry pathways

  • Species Specificity Barriers: Research has shown that temporary human PDGFRA expression did not complement GPCMV(PC-) infection , highlighting species-specificity barriers that need to be addressed in translational research.

  • Integration with Innate Immunity: Advanced studies have revealed that successful endothelial cell infection by GPCMV depends not only on gH-containing complexes but also on tegument pp65 protein (GP83) to counteract the IFI16/cGAS-STING innate immune pathway , indicating the complexity of successful infection beyond just entry.

What are the key considerations when designing experiments involving recombinant GPCMV gH?

When designing experiments with recombinant GPCMV gH, researchers should consider:

  • Expression System Selection:

    • Mammalian expression systems are preferred for proper folding and glycosylation

    • Co-expression with gL is critical for stability and proper trafficking

    • Consider the need for other complex components (gO, GP129, GP131, GP133) depending on the research question

  • Complex Formation:

    • The gH transmembrane domain and cytosolic tail play regulatory roles in trafficking

    • For pentamer studies, all five components must be correctly expressed and assembled

  • Cell Line Selection:

    • Different cell types express different receptors influencing gH complex requirements

    • Fibroblasts express PDGFRA and support trimer-mediated entry

    • Epithelial, endothelial, and placental cells typically lack PDGFRA and require pentamer-mediated entry

  • Functional Readouts:

    • Cell-cell fusion assays can assess fusion capability independent of full virus

    • Neutralization assays should include multiple cell types to fully assess protection

    • Consider viral genome quantification via ddPCR for sensitive detection in tissues

  • Animal Model Design:

    • Timing of infection during pregnancy is critical (embryonic vs. fetal period)

    • Viral load detection methods and timing influence outcomes

    • Consider the use of inbred vs. outbred guinea pigs (studies show different susceptibility)

How can researchers troubleshoot common challenges in GPCMV gH expression and functional studies?

Common challenges and troubleshooting strategies include:

  • Low Expression Levels:

    • Co-express with gL, which prevents proteasomal degradation of gH

    • Optimize codon usage for the expression system

    • Consider adding stabilizing domains like foldon trimerization motifs

    • Use proteasome inhibitors to evaluate degradation pathways

  • Improper Folding/Complex Formation:

    • Verify glycosylation status as proper N-linked glycosylation is important

    • Evaluate the impact of mutations on complex formation

    • Use pulse-chase experiments to track complex assembly kinetics

    • Consider chaperone co-expression

  • Lack of Functional Activity:

    • Ensure all necessary complex components are present

    • Verify cell surface expression by flow cytometry

    • Check receptor expression on target cells (e.g., PDGFRA, NRP2)

    • For neutralization studies, include complement in assays as some protection may be complement-dependent

  • Species-Specificity Barriers:

    • Human receptors may not complement GPCMV infection (e.g., human PDGFRA)

    • Consider creating chimeric receptors to understand species-specificity determinants

  • Variable Results in Animal Studies:

    • Standardize infection dose (typical dose: 2×10^5 PFU)

    • Consider timing of infection (21 dGA vs. 35 dGA shows different outcomes)

    • Account for strain differences (inbred strain 2 × strain 13 hybrids showed significantly higher placental viral loads than outbred Hartley guinea pigs)

    • Use multiple methods to detect congenital infection (amniotic fluid and multiple fetal tissues)

What are emerging areas of research involving GPCMV gH and its complexes?

Several promising research directions involving GPCMV gH are emerging:

  • Structure-Based Vaccine Design: Following approaches similar to those used for HCMV, researchers are working on structure-based design of stabilized prefusion forms of GPCMV glycoproteins for improved vaccine candidates .

  • Combined Glycoprotein Vaccines: Research has shown that combinations of glycoproteins (gB+gH/gL or gB+pentamer) induce synergistic neutralizing responses up to 17-fold higher than individual proteins , pointing toward optimized multi-component vaccines.

  • Maternal-Fetal Transmission Mechanisms: Detailed studies of how GPCMV crosses the placenta are revealing the kinetics of congenital infection and the role of gH-containing complexes in this process .

  • Persistent vs. Lytic Infection: Studies show that GPCMV can establish either persistent or lytic infection in endothelial cells depending on tissue origin , suggesting important implications for viral pathogenesis and long-term outcomes.

  • Innate Immune Evasion: Research is revealing connections between entry (mediated by gH complexes) and immune evasion mechanisms, such as the requirement for viral tegument protein pp65 to counteract innate immune pathways following endothelial cell infection .

  • Receptor Biology: Continued exploration of the receptors for different gH complexes (beyond PDGFRA and NRP2) could provide new insights into viral tropism and potential antiviral targets.

How might methodological advances improve our understanding of GPCMV gH function in viral pathogenesis?

Emerging methodological advances could significantly enhance our understanding of GPCMV gH:

  • Cryo-Electron Microscopy: High-resolution structural analysis of gH-containing complexes in their native prefusion state could reveal critical functional domains and target sites for neutralizing antibodies.

  • Single-Cell Technologies: Single-cell RNA sequencing of infected tissues could reveal cell-type specific responses to GPCMV infection and better define the tropism conferred by different gH complexes.

  • CRISPR/Cas9 Engineering: Continued application of genome editing to create receptor knockout cell lines and viral mutants will further define the molecular requirements for infection of specific cell types .

  • Organoid Models: Development of guinea pig placental or other tissue-specific organoids could provide more physiologically relevant systems for studying viral entry and spread mediated by gH complexes.

  • Improved Animal Models: Refinement of the guinea pig model through the use of defined genetic backgrounds, reporter viruses, and advanced imaging techniques could enable better visualization of viral dissemination and congenital transmission in vivo.

  • Systems Biology Approaches: Integration of proteomic, transcriptomic, and functional data could provide a more comprehensive understanding of how gH-containing complexes interact with host factors during infection.

  • Ancestral Sequence Reconstruction: Applying evolutionary analyses to cytomegalovirus glycoproteins could reveal conserved functional domains and potentially identify broadly protective epitopes for vaccine design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.