Recombinant Guinea pig Histamine H2 receptor (HRH2)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant Guinea pig HRH2 is synthesized using multiple expression systems, including:

Product CodeExpression SystemPuritySource
CSB-CF010738GUE. coli≥90% (SDS-PAGE)Cusabio
CSB-YP010738GU1Yeast≥85%Creative BioMart
CSB-EP010738GU1-BBaculovirus≥95%Creative BioMart

These systems enable large-scale production for applications like ELISA, Western blot, and functional assays .

Constitutive Activity and Ligand Selectivity

  • Guinea pig HRH2 exhibits lower basal constitutive activity than canine HRH2 but higher than human or rat isoforms .

  • Ligand-specific conformations influence receptor behavior. For example:

    • Metiamide acts as an inverse agonist in Guinea pig HRH2 but shows partial agonism in canine HRH2 .

    • Dimaprit and apromidine derivatives (e.g., BU-E-75) demonstrate potent agonist effects in Guinea pig cardiac tissue .

Signal Transduction

  • Binds histamine to activate Gsα proteins, increasing cAMP via adenylate cyclase .

  • Cross-talks with H1 receptors, modulating cAMP and IP3 pathways in cardiomyocytes .

Cardiovascular Studies

  • In Guinea pig hearts, HRH2 agonists increase contractility without affecting heart rate .

  • Heterodimerization with H1 receptors alters downstream signaling, as observed in transfected CHO cells .

Gastric Acid Secretion

  • Used to model histamine-induced acid secretion in parietal cells, informing therapies for ulcers and GERD .

Drug Development

  • Screens for H2 antagonists (e.g., cimetidine) leverage Guinea pig HRH2 due to its ligand-binding similarities to human receptors .

Key Pathways

PathwayAssociated Proteins
Neuroactive ligand-receptor interactionHTR6, HRH1, HRH3, HRH4
Calcium signalingPLC, PKC, TRPC channels

Protein Interactions

  • Directly binds cimetidine and aminopotentidine, validated via co-IP and pull-down assays .

Comparative Insights

SpeciesConstitutive ActivityLigand Selectivity Notes
Guinea pigModerateHigh affinity for BU-E-75
HumanLowSensitive to forskolin
CanineHighMetiamide acts as partial agonist

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate your request when placing the order. We will fulfill your specific demands.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. The activity of this receptor is mediated by G proteins, which activate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic molecular structure of the guinea pig histamine H2 receptor?

The guinea pig histamine H2 receptor is encoded by an intronless DNA sequence that produces a 359 amino acid protein. Northern blot analysis has identified a single transcript of 4.6 kb in peripheral tissues and brain areas. The receptor displays significant homology (83-86% identity) with rat, human, and dog H2 receptors, reflecting its evolutionary conservation across mammalian species .

How was the guinea pig H2 receptor initially cloned?

The guinea pig H2 receptor was cloned using a strategy based on nucleotide sequence homology, starting from the rat histamine H2 receptor sequence (Ruat et al., 1991). This approach successfully identified a highly homologous DNA sequence encoding the guinea pig H2 receptor . The cloning strategy leveraged the conserved regions between species to design appropriate primers and probes for isolating the guinea pig receptor gene.

Where is the H2 receptor gene located in the human genome?

Through Southern analysis of a chromosome mapping panel constructed from human x hamster hybridomas, researchers assigned the H2 receptor gene to human chromosome 5 . This chromosomal localization provides important information for comparative genomic studies and understanding potential regulatory mechanisms.

What is the tissue distribution pattern of the guinea pig H2 receptor?

The H2 receptor shows a distinctive expression pattern in guinea pigs. Northern blot analysis and in situ hybridization studies have revealed H2 receptor transcripts in various peripheral tissues and specific brain areas. The distribution of these transcripts is consistent with locations previously identified through photoaffinity labeling or binding studies . This expression pattern provides valuable information for researchers selecting appropriate tissues for receptor isolation or functional studies.

What expression systems are most effective for recombinant guinea pig H2 receptor studies?

While the search results don't directly address expression systems for guinea pig H2 receptors, researchers typically use mammalian cell lines (such as HEK293 or CHO cells) for G-protein coupled receptor expression. These systems provide the appropriate cellular machinery for receptor folding, post-translational modifications, and functional coupling to signaling pathways. For structural studies, insect cell lines and yeast expression systems might be considered, though each has specific advantages and limitations for histamine receptor research.

How does the pharmacological profile of guinea pig H2 receptor compare to other species?

The guinea pig H2 receptor shows some pharmacological differences compared to other species, similar to the documented species variations in H3 receptors. While histamine receptors show high sequence conservation across species (>90%), they can exhibit significant species-specific pharmacological properties in terms of ligand binding affinities and functional responses . These differences highlight the importance of species-appropriate models when evaluating H2 receptor ligands.

What are the standard methods for assessing recombinant guinea pig H2 receptor activity?

Functional assays for guinea pig H2 receptor typically include measurements of cAMP production (as H2 receptors couple primarily to Gs proteins), receptor binding assays with radiolabeled ligands, and calcium mobilization assays. In guinea pig models, researchers can also measure physiological parameters like heart rate, arterial pressure, and body temperature in response to receptor activation or blockade . These multiple approaches provide complementary information about receptor function.

What are the key considerations when designing an experiment using recombinant guinea pig H2 receptor?

When designing experiments with recombinant guinea pig H2 receptor, researchers should consider:

  • Expression system selection based on research objectives

  • Validation of receptor expression and functionality

  • Selection of appropriate control conditions

  • Choice of detection methods with sufficient sensitivity

  • Potential for receptor desensitization during prolonged stimulation

  • Species-specific pharmacology when selecting ligands

  • Post-translational modifications that might affect receptor function

These considerations ensure robust and reproducible results when working with recombinant H2 receptors.

How can I optimize transfection efficiency for recombinant guinea pig H2 receptor expression?

For optimal transfection efficiency when expressing recombinant guinea pig H2 receptor:

  • Select a mammalian cell line with high transfectability and low endogenous H2 receptor expression

  • Optimize DNA:transfection reagent ratios through systematic testing

  • Consider stable cell line development for consistent receptor expression

  • Validate receptor expression through immunoblotting, flow cytometry, or binding assays

  • Ensure cells are in optimal growth phase during transfection (typically 70-80% confluency)

  • Use serum-free media during transfection to prevent interference from serum components

What advantages does the guinea pig model offer for histamine receptor research compared to other animal models?

Guinea pigs have historically been the prototypic animal species for histamine H2 receptor research . They offer several advantages:

  • High sensitivity to histamine, making physiological responses readily measurable

  • Histamine receptor distribution pattern similar to humans

  • Established experimental protocols and extensive literature base

  • Appropriate size for physiological measurements and tissue collection

  • Well-characterized pharmacological responses to standard H2 ligands

These advantages make guinea pigs particularly valuable for translational histamine receptor research.

How can site-directed mutagenesis of recombinant guinea pig H2 receptor advance our understanding of receptor-ligand interactions?

Site-directed mutagenesis of the guinea pig H2 receptor allows researchers to systematically modify specific amino acid residues to determine their role in ligand binding, receptor activation, and signal transduction. By comparing mutated receptors with wild-type, researchers can identify:

  • Critical binding pocket residues for histamine and synthetic ligands

  • Amino acids involved in receptor activation mechanisms

  • Residues responsible for species-specific pharmacological differences

  • Domains important for G-protein coupling specificity

These studies provide molecular-level insights into receptor function that can guide drug discovery efforts.

What methods can be used to study dimerization or oligomerization of guinea pig H2 receptors?

To investigate potential dimerization or oligomerization of guinea pig H2 receptors, researchers can employ:

  • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) with differentially tagged receptors

  • Co-immunoprecipitation of differently tagged receptor variants

  • Cross-linking studies followed by size-exclusion chromatography

  • Functional complementation assays with receptor fragments

  • Single-molecule imaging techniques to visualize receptor complexes

These approaches help determine whether H2 receptors function as monomers or form higher-order structures that might influence signaling properties.

What are common challenges when working with recombinant guinea pig H2 receptor and how can they be addressed?

Common challenges when working with recombinant guinea pig H2 receptor include:

ChallengePotential Solutions
Low expression levelsOptimize codon usage, use stronger promoters, consider alternative expression systems
Receptor misfoldingAdjust culture temperature, include chaperone proteins, optimize signal peptide
Constitutive activityUse inverse agonists or salt concentration adjustments to stabilize inactive state
Rapid desensitizationUse pulse stimulation protocols, include phosphatase inhibitors
High background in functional assaysInclude appropriate controls, reduce expression of endogenous receptors
Species-specific pharmacologyAlways validate ligands with guinea pig receptor before extensive studies

How can I differentiate between guinea pig H2 receptor-specific effects and non-specific effects in my experimental system?

To differentiate specific H2 receptor effects from non-specific effects:

  • Include appropriate negative controls (untransfected cells, cells expressing irrelevant receptors)

  • Use multiple structurally distinct H2 receptor antagonists to block responses

  • Implement siRNA knockdown or CRISPR editing to reduce receptor expression

  • Compare concentration-response relationships with known receptor pharmacology

  • Utilize reporter systems specifically coupled to H2 receptor signaling pathways

  • Conduct parallel experiments in expression systems lacking endogenous histamine receptors

These approaches increase confidence that observed effects are mediated specifically through the H2 receptor.

How might advances in guinea pig genomics impact histamine H2 receptor research?

The advancement of guinea pig genomics, including projects like the Guinea Pig Genome Project by The Broad Institute, significantly enhances guinea pig research capabilities . These genomic resources enable:

  • More precise genetic manipulation of guinea pig H2 receptors

  • Identification of species-specific regulatory elements

  • Development of transgenic guinea pig models

  • Improved understanding of receptor gene structure and splice variants

  • Comprehensive analysis of histamine receptor family evolution

  • Better primer and probe design for molecular studies

These genomic advances will likely accelerate progress in histamine receptor research using guinea pig models.

What are the emerging applications of recombinant guinea pig H2 receptor in drug discovery?

Emerging applications of recombinant guinea pig H2 receptor in drug discovery include:

  • High-throughput screening platforms for novel H2 ligands

  • Structure-based drug design using homology models of the guinea pig receptor

  • Development of bispecific antibodies targeting H2 receptors and other therapeutic targets

  • Evaluation of species selectivity during early drug development

  • Creation of guinea pig disease models expressing mutant H2 receptors

  • Investigation of biased signaling pathways for therapeutic exploitation

These applications leverage the guinea pig model's historical importance while incorporating modern drug discovery technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.