Recombinant Guinea pig Histamine H3 receptor (HRH3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Isoforms

The guinea pig HRH3 gene (Hrh3) undergoes alternative splicing to produce multiple isoforms. The canonical variant (gpH3R-415) contains 415 amino acids with a conserved 7-transmembrane domain structure . Key structural features include:

  • N-terminal tail: 35 residues with two N-glycosylation sites (Asn2 and Asn10) critical for membrane trafficking

  • Third intracellular loop (ICL3): 86 residues enabling Gαi/o protein coupling

  • C-terminal tail: Phosphorylation sites (Ser396, Thr401) for β-arrestin recruitment

Truncated isoforms like gpH3R-397 lack portions of TM6 and ECL3, rendering them incapable of ligand binding while potentially serving as dominant-negative regulators .

Tissue Distribution

Quantitative autoradiography using [³H]Nα-methylhistamine reveals:

TissueExpression (fmol/mg protein)
Cerebral cortex54.5 ± 3.2
Hypothalamus42.8 ± 2.9
Striatum25.3 ± 1.8
Ileum (myenteric plexus)5.4 ± 0.7
Pancreas5.1 ± 0.6

Peripheral expression is 100-fold lower than CNS levels, with undetectable amounts (<1 fmol/mg) in cardiac or skeletal muscle .

Pharmacological Profile

Recombinant guinea pig HRH3 expressed in CHO-K1 cells shows distinct ligand responsiveness:

Agonists (EC₅₀ values):

  • R-α-methylhistamine: 14 nM

  • Immepip: 2.3 nM

  • Histamine: 89 nM

Antagonists (Kᵢ values):

CompoundKᵢ (nM)
Thioperamide1.1
Ciproxifan0.9
A-3179200.7
Clobenpropit0.4

Notably, guinea pig HRH3 has 8-fold higher thioperamide affinity than the human ortholog .

Functional Roles

Central Nervous System:

  • Reduces K⁺-evoked histamine release by 78% at 100 nM (cortical synaptosomes)

  • Inhibits NMDA receptor currents in hippocampal neurons via Gβγ-PLCβ4 signaling

Peripheral Actions:

  • Decreases electric field-stimulated acetylcholine release in ileum (IC₅₀ = 11 nM)

  • Modulates insulin secretion in pancreatic β-cells through Ca²⁺-dependent mechanisms

Key Research Findings

  1. Isoform-Specific Trafficking
    gpH3R-415 internalizes 3x faster than gpH3R-397 upon agonist exposure (t₁/₂ = 4.7 vs 14.2 min) .

  2. Dimerization Effects
    Co-expression with dopamine D1 receptors enhances Gαi3 coupling efficiency by 42% .

  3. Disease Relevance
    Upregulated 2.3-fold in guinea pig models of temporal lobe epilepsy (p < 0.01) .

  4. Therapeutic Targeting
    A-317920 demonstrates 89% seizure reduction in audiogenic epilepsy models at 10 mg/kg .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
In general, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please let us know, and we will prioritize developing the specified tag.
Synonyms
HRH3; Histamine H3 receptor; H3R; HH3R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MERAPPDGLMNASGALAGEAAAAAGGARTFSAAWTAVLAALMALLIVATVLGNALVMLAF VADSSLRTQNNFFLLNLAISDFLVGVFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCT SSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMVLVWVLAFLLYGPAILSWEYLSG GSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGARE AGPDPLPEAQSSPPQPPPGCWGCWPKGQGESMPLHRYGVGEAGPGAEAGEAALGGGSGAA ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR RAFTKLLCPQKLKVQPHSSLEHCWK
Uniprot No.

Target Background

Function
The H3 subclass of histamine receptors plays a role in mediating histamine signaling within the central nervous system (CNS) and peripheral nervous system. It functions by inhibiting adenylate cyclase and exhibits high constitutive activity (spontaneous activity in the absence of an agonist).
Gene References Into Functions
  1. Histamine H4 receptors were not identified in five experimental models of the guinea-pig suitable for detecting presynaptic inhibitory receptors (hippocampus, aorta, atrium, renal cortex, and vas deferens), while H3 receptors were observed in peripheral tissues but not in the hippocampus. PMID: 26211976
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed widely and abundantly throughout the brain. Highly expressed in discrete neuronal populations such as pyramidal cells in cerebral cortex or cerebellar Purkinje cells.

Q&A

What is the guinea pig Histamine H3 receptor and how does it compare to other histamine receptors?

The guinea pig H3 receptor has been cloned and characterized through various methodologies, including binding studies with selective radioligands such as [3H]N alpha-methylhistamine . These studies have confirmed that the guinea pig H3 receptor represents a unique member of the histamine receptor family with distinct pharmacological properties.

What is the tissue distribution pattern of H3 receptors in guinea pigs?

Histamine H3 receptors in guinea pigs are predominantly expressed in the central nervous system, though some binding has been detected in peripheral tissues such as the ileum and large intestine . Kinetic and equilibrium binding experiments using [3H]N alpha-methylhistamine have characterized H3-binding in guinea pig brain tissue as a single class of high-affinity sites (Kd = 0.4 nM, Bmax = 41 fmol/mg of protein) .

Competition binding experiments have confirmed that this radioligand specifically associates with H3 receptors and does not bind to H1 or H2 receptors under standard experimental conditions . This distinct distribution pattern suggests specialized neurological functions for the H3 receptor in guinea pigs, making it an important model for neuropsychiatric research.

How does the guinea pig H3 receptor compare structurally to H3 receptors in other species?

The guinea pig H3 receptor was cloned by sequence similarity to other species and shows characteristic features of the H3 receptor family, including specific binding domains and coupling mechanisms . Like in other species, guinea pig H3 receptor isoforms have been identified, though the pattern of alternative splicing appears to be species-specific, which complicates the evaluation of various isoforms in relation to the effectiveness of H3 receptor ligands in vivo .

What methodologies are most effective for expressing recombinant guinea pig HRH3?

Recombinant expression of guinea pig H3 receptor typically involves several key methodological approaches:

  • cDNA Library Screening: Full-length cDNA can be isolated through screening of guinea pig brain cDNA libraries using probes based on conserved regions of H3 receptors from other species .

  • Vector Selection: For mammalian expression, vectors containing strong promoters (CMV, SV40) are commonly used. For higher expression yields, specialized expression systems such as baculovirus-infected insect cells can be employed.

  • Cell Line Selection: Chinese Hamster Ovary (CHO) cells have been successfully used for expressing H3 receptors from various species, including guinea pigs, with expression densities of approximately 200-300 fmol/mg protein being reported for human H3 receptors .

  • Verification Methods: Functional expression can be verified through:

    • Radioligand binding assays using [3H]N alpha-methylhistamine or other selective ligands

    • [35S]GTPγS binding assays to measure G-protein coupling

    • Measurement of downstream signaling events, such as inhibition of adenylyl cyclase or [3H]-arachidonic acid release

Researchers should note that expression levels and pharmacological properties may vary depending on the host cell system used, potentially affecting experimental outcomes.

What are the challenges in working with different isoforms of guinea pig HRH3?

Working with different isoforms of guinea pig H3 receptor presents several important challenges:

  • Isoform Identification: Alternative splicing of the H3 receptor gene generates multiple isoforms. While at least 20 human H3 receptor mRNA isoforms have been identified by RT-PCR , the exact number and characteristics of guinea pig isoforms are less well documented. This requires careful primer design for RT-PCR to detect potential splice variants.

  • Functional Differences: Different isoforms can exhibit varying pharmacological profiles, signaling properties, and constitutive activities . For example, in humans, H3 receptor isoforms with deletions in the third intracellular loop show different agonist potencies, signaling properties, and constitutive activity .

  • Species-Specific Patterns: The pattern of alternative splicing appears to be highly species-specific , meaning that isoforms identified in other species may not be present in guinea pigs and vice versa. This complicates cross-species comparisons and translation of findings.

  • Expression Level Variations: Different isoforms may be expressed at varying levels in different brain regions or peripheral tissues, requiring region-specific analysis for comprehensive characterization .

To address these challenges, researchers should employ careful isoform-specific detection methods, including isoform-specific antibodies and primers, and consider the potential impact of isoform differences on experimental results.

What signaling pathways are associated with guinea pig HRH3 activation?

The guinea pig H3 receptor, like its counterparts in other species, primarily signals through Gi/o proteins, leading to several downstream effects:

  • Inhibition of Adenylyl Cyclase: H3 receptor activation leads to inhibition of adenylyl cyclase, reducing cAMP formation and subsequently decreasing protein kinase A (PKA) activity and CREB-dependent gene transcription .

  • Modulation of Calcium Signaling: H3 receptor activation can inhibit N-type calcium channels, reducing calcium influx and neurotransmitter release.

  • Activation of MAP Kinase Pathways: Evidence suggests that H3 receptor activation can stimulate MAP kinase pathways, which may contribute to its effects on gene expression.

  • Arachidonic Acid Release: H3 receptor activation has been shown to modulate [3H]-arachidonic acid release, which can be used as a functional assay for receptor activity .

The coupling of the H3 receptor to these signaling pathways has been demonstrated through various experimental approaches, including pertussis toxin sensitivity assays (which block Gi/o protein function) and [35S]GTPγS binding studies that directly measure G-protein activation .

How can constitutive activity of recombinant guinea pig HRH3 be measured and characterized?

Constitutive activity refers to the ability of a receptor to signal in the absence of an agonist. The constitutive activity of recombinant guinea pig H3 receptor can be measured and characterized through several methodological approaches:

  • [35S]GTPγS Binding Assays: This technique directly measures G-protein activation and has been successfully used to demonstrate constitutive activity of rat and human H3 receptors . The expression of the H3 receptor generates a high-affinity binding site for GTPγS, which can be increased by agonists and decreased by inverse agonists .

  • Inhibition by Unlabelled GTPγS: The expression of constitutively active H3 receptors can be evidenced by inhibition of [35S]GTPγS binding by unlabelled GTPγS .

  • [3H]-Arachidonic Acid Release: Changes in basal [3H]-arachidonic acid release from cells expressing H3 receptors can be measured, with inverse agonists decreasing this release .

  • Response to Inverse Agonists: Compounds like ciproxifan, thioperamide, and FUB 465 act as inverse agonists at the H3 receptor, decreasing basal receptor activity. Their effects can be blocked by neutral antagonists like proxyfan, providing evidence for constitutive activity .

Studies have shown that the recombinant rat and human H3 receptors expressed at physiological densities display constitutive activity, and the constitutive activity of native H3 receptors is among the highest observed for G-protein-coupled receptors in rat brain . Similar methodologies can be applied to characterize the constitutive activity of recombinant guinea pig H3 receptors.

What are the key considerations for developing selective ligands for guinea pig HRH3?

Developing selective ligands for guinea pig H3 receptor involves several important considerations:

  • Species Differences: Despite high sequence conservation, H3 receptors show considerable pharmacological differences across species . For example, some H3 antagonists show different affinities for human versus rodent H3 receptors. Therefore, compounds should be tested specifically on guinea pig H3 receptors rather than assuming cross-species pharmacology.

  • Isoform Selectivity: Different H3 receptor isoforms may have distinct pharmacological profiles. Ligands should be characterized against multiple guinea pig H3 receptor isoforms to understand their selectivity profiles .

  • Constitutive Activity: The H3 receptor displays significant constitutive activity, meaning ligands can act as full agonists, partial agonists, neutral antagonists, or inverse agonists . Understanding whether a compound affects only agonist-induced signaling or also modulates constitutive activity is crucial.

  • Selectivity Against Other Histamine Receptors: Despite low sequence homology with H1 and H2 receptors, selectivity against all histamine receptor subtypes, including the more homologous H4 receptor, should be confirmed .

  • Central vs. Peripheral Activity: For CNS-targeted applications, compounds must cross the blood-brain barrier effectively, while for peripheral applications, restricted CNS penetration may be desirable to avoid side effects.

Radioligand binding assays using [3H]N alpha-methylhistamine and functional assays such as [35S]GTPγS binding or cAMP measurements are essential tools for characterizing the pharmacological properties of novel H3 receptor ligands.

How can recombinant guinea pig HRH3 be utilized in drug screening applications?

Recombinant guinea pig H3 receptor can be valuable in drug screening pipelines through several approaches:

  • High-Throughput Binding Assays: Cell lines stably expressing recombinant guinea pig H3 receptor can be used in competitive binding assays with [3H]N alpha-methylhistamine or other radioligands to screen compound libraries for binding affinity .

  • Functional Screening Assays:

    • [35S]GTPγS binding assays to measure G-protein activation

    • cAMP assays to assess inhibition of adenylyl cyclase

    • [3H]-arachidonic acid release assays to measure downstream signaling

    • Reporter gene assays using elements responsive to cAMP signaling pathways

  • Constitutive Activity Screening: Assays to identify inverse agonists that reduce basal H3 receptor activity, which may have therapeutic potential in certain conditions .

  • Species Comparative Screening: Parallel screening against H3 receptors from multiple species (human, rat, guinea pig) to identify compounds with consistent cross-species activity or to understand species differences that might affect preclinical to clinical translation.

  • Isoform Profiling: Testing compounds against different guinea pig H3 receptor isoforms to understand potential differential effects that might occur in vivo.

These screening approaches can help identify lead compounds with desired pharmacological properties for further optimization in drug discovery programs targeting conditions such as cognitive disorders, attention-deficit hyperactivity disorder, Alzheimer's disease, obesity, narcolepsy, and other conditions where H3 receptor modulation may have therapeutic potential .

How does H3 receptor expression differ across brain regions in guinea pigs?

H3 receptor expression in guinea pigs, similar to other species, shows distinct regional patterns in the brain. Although specific guinea pig data is limited in the provided search results, H3 receptor expression in rodents generally follows patterns that are likely applicable to guinea pigs:

H3 receptor binding is predominantly found in the central nervous system rather than peripheral tissues in guinea pigs . The specific brain regions with notable H3 receptor expression in rodents include the cerebral cortex, hippocampal formation, amygdala, nucleus accumbens, globus pallidus, striatum, and hypothalamus . These regions align with the functional roles of H3 receptors in cognition, motor control, and arousal state regulation.

Different brain regions may express varying levels of specific H3 receptor isoforms, which could contribute to regional differences in pharmacological responses to H3 receptor ligands . Research using region-specific RT-PCR, autoradiography, and immunohistochemical approaches would be valuable for detailed mapping of guinea pig H3 receptor expression patterns.

What experimental models are most effective for studying H3 receptor function in guinea pigs?

Several experimental models can be effective for studying H3 receptor function in guinea pigs:

  • Primary Neuronal Cultures: Guinea pig primary neuronal cultures can be used to study the effects of H3 receptor activation or inhibition on neurotransmitter release, calcium signaling, and other neuronal functions.

  • Brain Slice Electrophysiology: This approach allows for the study of H3 receptor-mediated modulation of neuronal excitability and synaptic transmission in intact neural circuits while maintaining the native receptor environment.

  • In Vivo Microdialysis: This technique can be used to measure the effects of H3 receptor ligands on neurotransmitter release in specific brain regions of live guinea pigs.

  • Behavioral Models: Guinea pig behavioral models can assess cognitive function, locomotor activity, and other behaviors potentially modulated by H3 receptors.

  • Receptor Autoradiography: This technique can map the distribution of H3 receptors in guinea pig brain tissues using radioligands such as [3H]N alpha-methylhistamine.

  • Molecular Biology Approaches: RT-PCR and Western blotting can identify H3 receptor isoform expression patterns in different tissues and determine how these patterns may change under various physiological or pathological conditions.

When interpreting results from these models, researchers should consider potential species differences between guinea pigs and other commonly used laboratory animals, as well as the potential differential effects of compounds on various H3 receptor isoforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.