Recombinant Guinea pig Integrin beta-6 (ITGB6)

Shipped with Ice Packs
In Stock

Description

Biological Role and Functional Significance

ITGB6 exclusively pairs with the αv subunit to form integrin αvβ6, which is critical for:

  • TGF-β1 Activation: Binds latent TGF-β1 (bound to LAP) and releases active TGF-β1 via mechanical force .

  • Epithelial Cell Dynamics: Regulates wound healing, fibrosis, and cancer progression through TGF-β1-mediated pathways .

  • Disease Associations: Overexpressed in carcinomas (e.g., lung, colon) and linked to poor prognosis .

Key Research Findings:

  • TGF-β1 upregulates ITGB6 transcription via Smad3/4 binding to the promoter region at position -798 .

  • Basal αvβ6 expression in epithelial cells depends on autocrine TGF-β1 activation, forming a self-amplifying loop .

  • ITGB6-deficient mice exhibit chronic inflammation, emphysema, and periodontitis, mimicking TGF-β1-deficient phenotypes .

Applications in Research

Recombinant ITGB6 is widely used to:

  • Study Integrin Signaling: Investigate αvβ6-mediated TGF-β1 activation in fibrosis and cancer .

  • Develop Therapeutic Agents: Screen inhibitors targeting αvβ6 in preclinical models .

  • Diagnostic Assays: Serve as an antigen in ELISA and Western blot for antibody validation .

Production and Quality Control

  • Expression: Optimized in E. coli for high yield (~50 µg per batch) .

  • Purity: Verified via SDS-PAGE and mass spectrometry .

  • Stability: Sensitive to repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

Research Limitations and Future Directions

  • Challenges: Weak mRNA translational efficiency necessitates overexpression systems .

  • Opportunities: Engineered variants (e.g., tagged or truncated forms) to study domain-specific functions .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please contact us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing your requested tag.
Synonyms
ITGB6; Integrin beta-6; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-577
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
SASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEKPVSPFMKTTPEEIANPCSSIP YICLPTFGFKHILPLTNDAERFNEIVKKQKISANIDNPEGGFDAIMQAAVCKEKIGWRND SLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVMEYPTIGQLIDKVVQ NNVLLIFAVTQEQVPLYENYAKLIPGATVGLLHKDSGNILQLIISAYEELRSEVELEVLG DTEGLNLSFSAVCNNGTLFPHQKKCLHMKVGETASFNVTVSIPNCERKSRHVIIKPVGLG DTLEILVSPECSCDCQKEVEVNSSKCHNGNGSYQCGVCACNPGHMGPHCECGEDTLSTDS CKETPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGDNGDCECG ECVCRSGWTGEYCNCTTSTDTCISEDGTLCSGRGDCVCGKCVCTNPGASGPTCERCPTCS DPCNSKRSCIECHLSADGQPGEECVDKCKLAGVTISKEADFSKDSSVSCSLQGENECLIT FLISTDNEGKTIIHNISEKDCPKPPNIPMIMLGVSLA
Uniprot No.

Target Background

Function
Integrin alpha-V:beta-6 (ITGAV:ITGB6) is a receptor for fibronectin and cytotactin. It recognizes the R-G-D sequence within its ligands. ITGAV:ITGB6 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1. Integrin alpha-V:beta-6 (ITGAV:ITGB6) facilitates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a crucial role in TGF-beta-1 activation.
Database Links
Protein Families
Integrin beta chain family
Subcellular Location
Membrane; Single-pass type I membrane protein. Cell junction, focal adhesion.

Q&A

What is Integrin beta-6 and what role does it play in viral infections?

Integrin beta-6 (ITGB6) is a transmembrane protein that pairs with the alpha-v subunit to form the αvβ6 integrin receptor on epithelial cell surfaces. This heterodimeric receptor plays a critical role in the mechanism by which foot-and-mouth disease virus (FMDV) initiates infection of cells. The viral capsid of FMDV attaches to host integrins, particularly αvβ6, on the surface of target cells to facilitate viral entry. Research has demonstrated that integrin αvβ6 can interfere with FMDV in vitro, resulting in neutralization of its infectivity .

The importance of ITGB6 in viral pathogenesis extends beyond mere attachment. When recombinant integrin extracellular domains are expressed and formulated with adjuvants, they can induce protective immune responses. Specifically, guinea pigs inoculated with the β6-1 domain (containing the ligand-binding region) demonstrated 50% protection from FMDV challenge, whereas those inoculated with the β6-2 domain showed no protection . This differential protection highlights the specific role of the binding domain in virus-host interactions and suggests potential for integrin-based antiviral strategies.

How is the ITGB6 gene expression regulated at the molecular level?

The regulation of ITGB6 gene expression involves a sophisticated feedback mechanism centered around transforming growth factor beta-1 (TGFβ1). Research demonstrates that TGFβ1 increases mRNA levels of the β6 integrin subunit (ITGB6) in epithelial cells in a time- and concentration-dependent manner. The expression typically peaks at a TGFβ1 concentration of 2 ng/ml and decreases at higher concentrations (5-10 ng/ml) .

TGFβ1-induced ITGB6 expression occurs through transcriptional activation rather than by affecting mRNA stability. This has been confirmed through experiments using actinomycin D, which showed no difference in ITGB6 mRNA decay rates between TGFβ1-treated cells (half-life = 5.9 hours) and untreated cells (half-life = 5.5 hours) .

A particularly interesting aspect of ITGB6 regulation is the autocrine loop involving αvβ6 integrin-mediated TGFβ1 activation. Basal expression of ITGB6 in lung epithelial cells occurs via homeostatic αvβ6-mediated TGFβ1 activation even in the absence of exogenous stimulation. This baseline expression can be inhibited by blocking antibodies directed against either TGFβ or αvβ6 integrin, confirming the presence of this self-sustaining regulatory mechanism .

What methodologies exist for cloning and expressing recombinant ITGB6?

The expression of recombinant ITGB6 typically involves a multi-step process comprising gene cloning, vector construction, protein expression, and purification. Based on published methodologies, researchers can follow these detailed steps:

  • Gene amplification: The full-length ITGB6 gene can be amplified from appropriate tissue (e.g., epithelial cells) using PCR with specific primers. For guinea pig ITGB6, primers should be designed based on conserved regions identified through sequence alignment with other species .

  • Vector construction: The amplified ITGB6 gene is first inserted into a cloning vector (e.g., pGEX) for sequence verification and subsequent manipulation. Following verification, specific domains can be selectively amplified for expression. For example, separate segments like β6-1 (containing the RGD-binding site) and β6-2 (remaining extracellular domain) can be amplified using domain-specific primers .

  • Expression vector preparation: The verified gene segments are then subcloned into an expression vector such as pET30a. The recombinant plasmids should be confirmed by restriction enzyme digestion (e.g., with BamHI and XholI) and sequencing .

  • Protein expression: The recombinant plasmids are transformed into an appropriate expression system, typically E. coli strains optimized for protein expression. Expression is induced under controlled conditions, and proteins are harvested and purified using affinity chromatography methods appropriate to the tags incorporated in the expression vector .

  • Protein characterization: The expressed proteins should be characterized using techniques such as western blotting, ELISA, and functional assays to confirm identity, purity, and biological activity .

The structure and biochemical properties of ITGB6 can be predicted using various bioinformatics tools including EMBOSS/pepstates, EMBOSS/antigenic, EMBOSS/tmap, ScanProsite, and Signal 3.0 Server for comprehensive characterization .

How does TGFβ1 signaling regulate ITGB6 expression through the Smad pathway?

TGFβ1-induced ITGB6 expression occurs via canonical Smad signaling, with specific molecular mechanisms now well characterized. The ITGB6 promoter region contains five canonical Smad binding sites with CAGA motifs, but research has identified the site at position -798 from the transcription start site (TSS) as particularly critical .

When TGFβ1 binds to its receptor, it initiates a signaling cascade that activates Smad proteins. Experimental evidence using dominant negative (dn) constructs directed against Smad2, Smad3, and Smad4 demonstrates that all three Smad proteins are involved in regulating ITGB6 promoter activity, with dnSmad3 showing the most pronounced inhibitory effect on both basal and TGFβ1-induced ITGB6 expression .

Chromatin immunoprecipitation (ChIP) assays confirm that both Smad3 and Smad4 directly bind to the ITGB6 promoter region around -798 from the TSS within 1 hour following TGFβ1 stimulation. While Smad2 also binds to this promoter region after TGFβ1 stimulation, its binding pattern is more variable. Importantly, none of these Smad proteins bind to control regions of DNA approximately 1.6kb upstream that lack Smad binding sites, confirming the specificity of the interaction .

Site-directed mutagenesis of the Smad binding site at -798 completely abolishes TGFβ1-induced ITGB6 transcriptional activity, demonstrating the crucial role of this specific site in regulating ITGB6 expression . This precise molecular mechanism provides researchers with specific targets for experimental manipulation when studying ITGB6 regulation.

What experimental designs can evaluate the protective effects of recombinant ITGB6 against FMDV infection?

Evaluating the protective effects of recombinant ITGB6 against FMDV infection requires a comprehensive experimental approach that combines in vitro and in vivo methodologies. Based on published research, the following experimental design is recommended:

  • Recombinant protein preparation: Express distinct domains of ITGB6 (e.g., β6-1 containing the ligand-binding domain and β6-2 containing other extracellular regions) as recombinant proteins. Purify and formulate these proteins with appropriate adjuvants for immunization .

  • Animal immunization protocol: Immunize guinea pigs (preferred model for initial testing due to cost-effectiveness and susceptibility to FMDV) with the recombinant proteins. A typical protocol involves multiple immunizations over several weeks to establish robust immune responses .

  • Antibody response assessment: Evaluate serum antibody responses against the recombinant ITGB6 proteins using western blot analysis and ELISA. This confirms successful immunization and allows quantification of antibody titers .

  • T cell response analysis: Measure CD4+ T cell proliferation in response to the recombinant proteins, as T cell responses play an important role in protection against FMDV. Comparative analysis between different protein domains (e.g., β6-1 vs. β6-2) provides insights into their immunogenic potential .

  • In vitro virus neutralization assay: Assess the neutralizing capacity of immune sera using a plaque formation assay. Specifically, incubate cells expressing αvβ6 (e.g., CHO-K1-αvβ6) with sera from immunized animals, then inoculate with FMDV and quantify plaque formation. A reduction in plaque formation indicates neutralizing activity .

  • FMDV challenge: Challenge immunized animals with virulent FMDV to evaluate protection under controlled conditions. Monitor animals for clinical signs of infection, viral shedding, and viremia over an appropriate time period .

  • Statistical analysis: Compare protection rates, antibody titers, T cell responses, and virus neutralization capacity between groups immunized with different protein domains and control groups to determine efficacy .

This experimental design allows researchers to systematically evaluate whether recombinant ITGB6 domains can induce protective immunity against FMDV infection and identify which specific domains are most effective.

What considerations should researchers take into account when designing ITGB6 constructs from different species?

When designing ITGB6 constructs from different species, researchers must consider several critical factors to ensure successful expression and functional relevance:

By carefully considering these factors, researchers can design ITGB6 constructs that express efficiently and maintain functional relevance for their specific experimental objectives.

How can researchers analyze ITGB6-mediated TGFβ activation in experimental systems?

Analysis of ITGB6-mediated TGFβ activation requires a multi-faceted approach combining molecular, cellular, and functional assays. The following methodological framework provides researchers with comprehensive techniques for investigating this process:

  • Basal ITGB6 expression analysis: Quantify baseline ITGB6 mRNA using RT-qPCR and protein expression using western blotting and flow cytometry. This establishes the foundation for understanding subsequent activation dynamics .

  • Manipulation of TGFβ signaling: Utilize specific inhibitors such as:

    • Pan-TGFβ blocking antibodies to neutralize all TGFβ isoforms

    • SB431542 to inhibit TGFβ receptor kinase activity (Alk5)

    • αvβ6-specific blocking antibodies (e.g., 6.3G9) to prevent integrin-mediated TGFβ activation

  • Temporal analysis of ITGB6 expression: Monitor changes in ITGB6 mRNA and protein expression over time (16-48 hours) following TGFβ manipulations to capture the dynamics of the autocrine regulatory loop .

  • Promoter activity assessment: Transfect cells with pGL3-ITGB6 promoter luciferase reporter constructs to directly measure transcriptional activity in response to treatments. This can be combined with site-directed mutagenesis of Smad binding sites to evaluate their functional significance .

  • TGFβ activity bioassays: Measure downstream TGFβ targets such as PAI1 mRNA to confirm successful modulation of TGFβ signaling. This serves as a positive control for interventions targeting the pathway .

  • Chromatin immunoprecipitation (ChIP): Perform ChIP assays to detect binding of Smad proteins (Smad2, Smad3, Smad4) to the ITGB6 promoter following TGFβ stimulation. This directly confirms the molecular mechanisms of transcriptional regulation .

  • Dominant negative approaches: Utilize dominant negative constructs for Smad2, Smad3, and Smad4 to selectively inhibit specific components of the canonical TGFβ signaling pathway and assess their individual contributions to ITGB6 regulation .

  • Stimulus response analysis: Test the response of the ITGB6-TGFβ axis to various relevant stimuli such as lysophosphatidic acid (LPA), which has been shown to induce αvβ6-mediated TGFβ activation .

This comprehensive analytical framework allows researchers to thoroughly investigate the complex interplay between ITGB6 expression and TGFβ activation, from molecular mechanisms to functional outcomes in experimental systems.

What are the critical quality control parameters for recombinant ITGB6 production?

Ensuring the quality of recombinant ITGB6 preparations is essential for reliable research outcomes. Based on established protocols, researchers should implement the following quality control parameters throughout the production process:

  • Sequence verification: Before expression, confirm the accuracy of the cloned ITGB6 gene sequence through comprehensive DNA sequencing. Pay particular attention to the integrity of functional domains, especially the ligand-binding region in constructs like β6-1 .

  • Expression validation: Verify successful protein expression through:

    • SDS-PAGE analysis to confirm correct molecular weight

    • Western blotting using specific anti-ITGB6 antibodies to confirm identity

    • Mass spectrometry for precise molecular characterization

  • Purity assessment: Evaluate protein purity using:

    • Densitometric analysis of stained gels (>90% purity typically required)

    • Size exclusion chromatography to detect aggregates or degradation products

    • Endotoxin testing for preparations intended for in vivo use (<1 EU/mg protein)

  • Structural integrity: Assess protein folding and structure through:

    • Circular dichroism spectroscopy to evaluate secondary structure

    • Thermal shift assays to determine stability

    • Limited proteolysis to verify domain organization

  • Functional activity: Confirm biological activity through:

    • Binding assays with natural ligands (e.g., RGD-containing peptides)

    • Cell adhesion assays using αvβ6-dependent cell lines

    • Virus neutralization assays for constructs intended for protection studies

  • Immunogenicity assessment: For constructs designed as immunogens, evaluate:

    • Antibody induction capacity in test animals

    • Specificity of induced antibodies against target epitopes

    • T cell stimulation potential

  • Batch consistency: Implement controls to ensure batch-to-batch reproducibility:

    • Reference standards for comparative analysis

    • Stability testing under various storage conditions

    • Functional comparison between batches

  • Contaminant testing: Screen for common contaminants from expression systems:

    • Host cell proteins (<100 ppm)

    • Host cell DNA (<10 ng per dose for in vivo applications)

    • Process-related impurities (e.g., imidazole from His-tag purification)

Rigorous application of these quality control parameters ensures that recombinant ITGB6 preparations meet the standards required for reliable research applications, from basic mechanistic studies to potential therapeutic development.

How does guinea pig ITGB6 compare structurally and functionally to human and mouse orthologs?

Guinea pig ITGB6 shares significant structural and functional similarities with human and mouse orthologs, but with important species-specific differences that researchers should consider. While complete guinea pig ITGB6 sequence data is limited in the provided search results, we can draw inferences from comparative studies of human and mouse ITGB6, which show approximately 90% sequence homology .

The conservation of ITGB6 across species reflects its fundamental biological importance, particularly in epithelial cell function and as a viral receptor. Key functional domains, especially the ligand-binding region that interacts with RGD motifs, show higher conservation than variable regions. This conservation has important implications for cross-species experimental designs, particularly when using recombinant proteins from one species in another .

  • Receptor-ligand interactions: Subtle variations in binding domain structure could influence affinity for ligands including FMDV serotypes and TGFβ.

  • Immune recognition: When using recombinant proteins as immunogens, species differences may affect epitope recognition and subsequent immune responses. This is particularly relevant when evaluating protection against FMDV infection .

  • Signaling pathways: While TGFβ-mediated regulation of ITGB6 expression appears conserved across species, the efficiency and dynamics of this regulation may vary. Experiments in both human bronchial epithelial cells and small airway epithelial cells demonstrate similar responses to TGFβ manipulations, suggesting conservation of regulatory mechanisms across different epithelial cell types .

  • Potential for autoimmune reactions: Using species-matched ITGB6 in experimental animals can trigger autoimmune reactions. This emphasizes the importance of using heterologous ITGB6 in animal studies to prevent self-reactivity complications .

These comparative insights guide researchers in designing appropriate experimental systems for studying ITGB6 biology and its applications in understanding disease mechanisms and developing interventional strategies.

What are the methodological challenges in measuring ITGB6 expression in different experimental systems?

Accurate measurement of ITGB6 expression presents several methodological challenges that researchers must address to obtain reliable results across different experimental systems:

  • mRNA vs. protein expression discrepancies: ITGB6 mRNA levels may not directly correlate with functional αvβ6 integrin surface expression due to post-transcriptional regulation. Research shows that while TGFβ1 stimulation causes rapid increases in ITGB6 mRNA (maximal between 16-24 hours), significant increases in cell surface αvβ6 integrin expression may require longer periods (3-7 days) to reach maximum levels . This temporal disconnect necessitates measuring both mRNA and protein expression at multiple time points.

  • Heterodimeric nature of functional integrin: ITGB6 must pair with αv subunit to form functional αvβ6 integrin. Therefore, measuring ITGB6 expression alone may not reflect functional receptor levels if αv availability is limiting. Flow cytometry with antibodies specific to the αvβ6 heterodimer (rather than individual subunits) provides more accurate assessment of functional receptor expression .

  • Basal expression variability: The autocrine loop of αvβ6-mediated TGFβ activation that regulates basal ITGB6 expression can vary between cell types and culture conditions. This variability necessitates careful characterization of baseline expression in each experimental system before perturbation experiments .

  • Species-specific reagent limitations: Availability of antibodies and detection reagents varies between species. While human and mouse ITGB6 have well-characterized reagents, those for guinea pig ITGB6 may be more limited, requiring validation of cross-reactivity when using reagents developed for other species .

  • Non-specific binding in immunoassays: Some anti-ITGB6 antibodies may cross-react with other integrin β subunits, necessitating careful validation through appropriate controls, including ITGB6-knockout or knockdown samples .

  • Transient transfection efficiency: When using reporter constructs to measure ITGB6 promoter activity, variations in transfection efficiency can confound results. Inclusion of internal control reporters (e.g., Renilla luciferase) for normalization is essential .

  • Context-dependent expression dynamics: ITGB6 expression responses to stimuli like TGFβ1 can be concentration-dependent, with maximal effects at specific concentrations (e.g., 2ng/ml) and diminished responses at higher concentrations. This non-linear response necessitates careful dose-response studies .

Addressing these methodological challenges through appropriate experimental design and controls ensures robust and reproducible measurement of ITGB6 expression across different experimental systems.

What are emerging approaches for targeting ITGB6 in therapeutic development?

The involvement of ITGB6 in various disease processes, particularly through its role in TGFβ activation and as a viral receptor, positions it as an attractive therapeutic target. Several emerging approaches show promise for therapeutic development:

  • Integrin blockade strategies: Research demonstrating that the β6-1 domain (containing the ligand-binding region) provides 50% protection against FMDV challenge in guinea pigs suggests that targeting specific functional domains of ITGB6 may effectively interfere with pathogen-host interactions . Development of domain-specific antibodies or peptide mimetics that selectively block viral binding without disrupting physiological functions represents a refined approach to anti-viral therapeutics.

  • Transcriptional regulation targeting: The elucidation of specific Smad binding sites in the ITGB6 promoter, particularly the critical site at -798 from the transcription start site, provides precise molecular targets for interventions aimed at modulating ITGB6 expression . Approaches could include small molecules that interfere with Smad-DNA interactions or targeted epigenetic modifications of the promoter region.

  • Disruption of the αvβ6-TGFβ autocrine loop: The discovery that basal ITGB6 expression depends on homeostatic αvβ6-mediated TGFβ activation suggests that targeted interruption of this feedback loop could modulate ITGB6 levels in pathological conditions . Selective inhibitors that disrupt this autocrine loop without affecting other TGFβ signaling pathways could offer therapeutic specificity.

  • Species-specific integrin targeting: The observation that using heterologous ITGB6 prevents autoimmune complications highlights the importance of species considerations in therapeutic development . This suggests potential for developing species-specific targeting approaches that minimize cross-reactivity and associated adverse effects.

  • Combination approaches with TGFβ pathway modulators: The complex interplay between ITGB6 expression and TGFβ signaling suggests that combination approaches targeting multiple points in this pathway might provide synergistic therapeutic effects . For example, combining αvβ6 blocking agents with selective TGFβ receptor inhibitors could enhance efficacy in conditions characterized by dysregulated TGFβ activity.

These emerging approaches represent promising directions for therapeutic development targeting ITGB6, with potential applications ranging from infectious disease prevention to management of fibrotic conditions where aberrant TGFβ activation plays a pathological role.

How might advanced structural biology techniques enhance our understanding of ITGB6 function?

Advanced structural biology techniques offer transformative potential for elucidating ITGB6 function at the molecular level, providing insights that could drive both basic research and therapeutic development:

  • Cryo-electron microscopy (Cryo-EM): This technique can reveal the three-dimensional structure of the complete αvβ6 integrin heterodimer in different conformational states (active vs. inactive), providing insights into activation mechanisms and ligand binding dynamics. Cryo-EM is particularly valuable for studying membrane proteins like integrins that are challenging to crystallize.

  • X-ray crystallography of domain-specific structures: While crystallizing full-length integrins is challenging, focusing on critical domains like the β6-1 ligand-binding region that confers protection against FMDV could reveal atomic-level details of virus-receptor interactions . Such structures would facilitate rational design of inhibitors that specifically block viral binding.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map conformational changes in ITGB6 upon interaction with various ligands, including FMDV capsid proteins and TGFβ. HDX-MS is particularly useful for identifying allosteric sites that undergo structural changes during protein-protein interactions, potentially revealing new targetable regions.

  • Single-molecule FRET (smFRET): By monitoring the real-time dynamics of labeled ITGB6 molecules, researchers can observe conformational changes during activation and ligand binding at the single-molecule level. This could elucidate the kinetics and energy landscape of these transitions, which are difficult to capture with static structural techniques.

  • Integrative structural biology approaches: Combining multiple techniques (X-ray crystallography, NMR, Cryo-EM, computational modeling) can provide comprehensive structural insights that no single method can achieve alone. This is particularly valuable for understanding complex assemblies like the αvβ6-TGFβ-LTBP (Latent TGF-β Binding Protein) complex that mediates TGFβ activation.

  • AlphaFold and other AI-based structure prediction tools: These emerging computational approaches can predict protein structures with unprecedented accuracy, potentially providing models of species-specific ITGB6 variants where experimental structures are unavailable. Comparative analysis of predicted structures from different species could highlight functional differences relevant to experimental design .

  • In situ structural studies: Techniques like correlative light and electron microscopy (CLEM) can visualize ITGB6 within its cellular context, revealing how its organization and interactions are influenced by the membrane environment and cytoskeletal associations.

These advanced structural biology approaches would significantly enhance our understanding of ITGB6 function beyond what is possible with biochemical and cellular techniques alone, potentially revealing new mechanistic insights and therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.