Recombinant Guinea pig Inward rectifier potassium channel 13 (KCNJ13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ13; Inward rectifier potassium channel 13; Inward rectifier K(+ channel Kir7.1; Potassium channel, inwardly rectifying subfamily J member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
KCNJ13
Target Protein Sequence
MESSNCKVITPLLSQRHRRMVTKDGHSTLQTDGAPRGLVYLRDAWGTLIDMRWRWVMLVF SASFVLHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH RDGKPNLIFQVANIRHSPLTSVRVSAVLYQERENGQLHQTSVDFHLDGISSEECPFFIFP LTYYHSITPSSPLVTLLQHENPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA SLLTRGSKGEYKVKMENFDKTVPELPTPLVSKSPHRTDLDIRINGQSIDNFQISETGLTE
Uniprot No.

Target Background

Function

Inward rectifier potassium channels are characterized by a preferential influx of potassium ions. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium blockage of outward current. KCNJ13 exhibits low single-channel conductance, low sensitivity to blockade by external barium and cesium, and no magnesium-dependent inward rectification.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ13 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is KCNJ13 and what are its known physiological functions?

KCNJ13 encodes the inwardly rectifying potassium channel Kir7.1, which is expressed in various tissues including the retina and tracheal smooth muscle. This channel plays a crucial role in ion homeostasis, particularly in the retinal pigment epithelium (RPE) where it localizes to the apical membrane . Functionally, it contributes to the maintenance of membrane potential and is essential for proper cell alignment and polarity in smooth muscle tissues . Defects in KCNJ13 function are associated with childhood blindness and abnormal organ development, suggesting its fundamental importance in tissue physiology and morphogenesis.

How is the KCNJ13 protein structurally characterized?

The human KCNJ13 gene consists of three exons that encode a Kir7.1 protein of 360 amino acids . Like other inwardly rectifying potassium channels, Kir7.1 has a structure that facilitates the greater influx of potassium ions than efflux, creating rectification. The protein contains specific domains associated with its function:

DomainFunction
Transmembrane domainsForm the channel pore across the cell membrane
Pore regionDetermines ion selectivity
Cytoplasmic domainsMediate regulation and interaction with other proteins

Various recombinant forms of KCNJ13 have been produced using expression systems including cell-free, E. coli, yeast, baculovirus, and mammalian cells, typically achieving ≥85% purity as determined by SDS-PAGE .

What approaches are most effective for generating KCNJ13 knockout models?

Several strategies have proven effective for manipulating KCNJ13 expression:

  • CRISPR/Cas9 gene editing: Researchers have successfully generated KCNJ13 knockout models by designing guide RNAs targeting sequences ~100 bases downstream of the start codon and in the 3'UTR region. This approach deleted most of exons 2 and 3, resulting in an N-terminal-only protein of about 60 amino acids .

  • shRNA-mediated suppression: Studies have used shRNA to suppress Kir7.1 expression in mice, allowing for the assessment of channel function without permanent genetic modification .

  • Conditional knockout models: Flox/flox Kcnj13 mice have been developed using the Cre-lox system for tissue-specific deletion of the gene .

  • Point mutations: T38C/T38C Kcnj13 mutation models have been used to study specific alterations in channel function .

When developing knockout models, researchers should include validation through sequencing, immunostaining, and assessment of potential off-target effects. In the case of CRISPR/Cas9 targeting of KCNJ13, RFX1 has been identified as a potential off-target gene that should be screened .

What pharmacological tools are available for studying KCNJ13 function?

VU590 has been established as an effective pharmacological inhibitor of KCNJ13/Kir7.1 channels. At a concentration of 50 μM, VU590 effectively blocks channel function and induces membrane depolarization in smooth muscle cells . This inhibitor provides researchers with a valuable tool for acute manipulation of channel activity without genetic modification. Ex vivo treatment of tracheal tissue with VU590 for 48 hours demonstrated significant functional effects, including shortened trachea and altered smooth muscle cell alignment, mimicking the phenotype of genetic knockout models .

How do mutations in KCNJ13 contribute to retinal pathologies?

Mutations in KCNJ13 are causally linked to Leber congenital amaurosis type 16 (LCA16), a form of childhood blindness characterized by severely impaired retinal function . Nonsense mutations resulting in truncated, non-functional Kir7.1 proteins lead to abolishment of normal electroretinogram (ERG) responses .

Specifically, disruption of KCNJ13 function affects multiple components of the ERG:

ERG ComponentOriginEffect of KCNJ13 Disruption
a-wavePhotoreceptor hyperpolarizationReduced amplitude
b-waveON-bipolar cell depolarizationReduced amplitude
c-waveRPE responseReduced amplitude

What role does KCNJ13 play in smooth muscle development and organ morphogenesis?

KCNJ13 is essential for proper smooth muscle cell alignment, polarity, and organ development. Studies have shown that Kcnj13 mutant mice exhibit:

  • Shortened trachea and esophagus

  • Disorganized smooth muscle layers

  • Altered cellular alignment and polarity

The developmental expression pattern of KCNJ13 in esophageal smooth muscle cells begins weakly at E12.5 and increases as the tissue develops. By E13.5, normal smooth muscle cells develop spindle shapes and become circumferentially aligned, whereas T38C/T38C Kcnj13 mutant mice display disorganized smooth muscle with altered cell alignment and polarity .

The mechanism linking KCNJ13 function to smooth muscle morphology involves:

  • Maintenance of membrane potential (KCNJ13 dysfunction causes membrane depolarization)

  • Regulation of actin cytoskeleton (membrane depolarization decreases F-actin levels)

  • Control of cell shape and alignment through actin organization

This reveals a broader role for KCNJ13 in epithelial tubulogenesis beyond retinal function.

What techniques are most effective for assessing KCNJ13 channel activity?

Several complementary approaches can be used to assess KCNJ13/Kir7.1 channel activity:

  • Membrane potential measurement: The voltage-sensitive fluorescent dye DiBAC₄(3) has been successfully used to detect membrane depolarization resulting from KCNJ13 dysfunction. Higher fluorescence intensity indicates membrane depolarization .

  • Electroretinogram (ERG) recording: ERG provides a functional readout of KCNJ13 activity in the retina, with measurements of a-, b-, and c-wave amplitudes serving as indicators of channel function .

  • Cytoskeletal organization assessment: Phalloidin staining to visualize F-actin content provides an indirect measure of KCNJ13 function, as channel activity affects membrane potential, which in turn regulates actin organization .

  • Immunodetection methods: Western blotting using specific antibodies (e.g., KCNJ13 Rabbit pAb) enables detection of protein expression levels .

When designing experiments to assess KCNJ13 function, researchers should include appropriate controls such as wild-type siblings for genetic studies, vehicle treatments for pharmacological interventions, and baseline measurements for functional assays.

How can researchers differentiate between KCNJ13 and other potassium channels in experimental systems?

Differentiating KCNJ13/Kir7.1 from other potassium channels requires multiple strategies:

  • Specific antibodies: KCNJ13 Rabbit polyclonal antibodies that recognize human and mouse variants are available for Western blot applications . These antibodies target unique epitopes in KCNJ13 that are not present in other potassium channels.

  • Genetic targeting: Using gene-specific targeting with CRISPR/Cas9 or shRNA approaches ensures selective manipulation of KCNJ13 without affecting other potassium channels .

  • Pharmacological specificity: VU590 at 50 μM concentration shows selectivity for Kir7.1 channels, providing a tool to distinguish its function from other potassium channels .

  • Tissue distribution pattern: KCNJ13/Kir7.1 has a distinctive expression pattern, with high expression in retinal pigment epithelium and developing smooth muscle cells . This pattern can help distinguish it from other potassium channels with different tissue distributions.

What cellular processes are downstream of KCNJ13 activity, and how can they be measured?

KCNJ13 function affects several downstream cellular processes that can be experimentally measured:

  • Membrane potential regulation: Measurable using voltage-sensitive dyes like DiBAC₄(3)

  • Actin cytoskeleton organization: Quantifiable through phalloidin staining for F-actin content and morphological analysis of actin filament arrangement

  • Cell shape and alignment: Assessable through microscopic analysis of cell morphology and orientation relative to tissue axes

  • Phagocytic activity in RPE cells: Measurable using uptake assays with fluorescently labeled photoreceptor outer segments (POSs)

  • Gene expression changes: Detectable through quantitative PCR analysis of phagocytosis-related genes and other downstream targets

The molecular pathway appears to follow this sequence: KCNJ13 dysfunction → membrane depolarization → decreased F-actin content → altered cell shape and alignment → tissue morphogenesis defects . Each step in this pathway can be experimentally measured to provide a comprehensive understanding of KCNJ13's role in cellular physiology.

How can stem cell models be used to study KCNJ13 function in human disease?

Human-induced pluripotent stem cells (hiPSCs) provide a valuable model system for studying KCNJ13 function in human disease contexts. The following approach has been validated:

  • Generate KCNJ13 knockout hiPSCs using CRISPR/Cas9 gene editing

  • Differentiate these cells into retinal pigment epithelial cells (hiPSC-RPEs)

  • Confirm knockout by immunostaining for Kir7.1 protein

  • Assess functional consequences through assays such as phagocytosis of photoreceptor outer segments

  • Analyze expression of downstream genes through quantitative PCR

This stem cell-based approach allows researchers to model human disease-causing mutations in a relevant cellular context and investigate the functional consequences of KCNJ13 deficiency on specific cellular processes.

What are the challenges in producing functional recombinant KCNJ13 proteins for structural studies?

While the search results don't directly address challenges in producing functional recombinant KCNJ13 proteins, they do indicate that various expression systems have been used, including cell-free expression, E. coli, yeast, baculovirus, and mammalian cell systems . Each system likely presents different challenges for producing properly folded, functional ion channels.

For membrane proteins like KCNJ13, common challenges include:

  • Proper membrane insertion and folding

  • Formation of functional tetrameric channels

  • Post-translational modifications that may affect function

  • Purification while maintaining native conformation

  • Stability during storage and experimental procedures

Current standards include achieving ≥85% purity as determined by SDS-PAGE , but functional validation through electrophysiological methods would be necessary to confirm channel activity of recombinant proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.