Recombinant Guinea pig Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; Cardiac inward rectifier potassium channel; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

This protein likely plays a role in establishing action potential waveforms and the excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater influx of potassium ions compared to efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification primarily results from internal magnesium block. The channel is blocked by external barium or cesium.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.

Q&A

What is Guinea pig Inward rectifier potassium channel 2 and what are its fundamental properties?

Guinea pig Inward rectifier potassium channel 2 (gpKCNJ2) is a critical ion channel primarily expressed in cardiac and neuronal tissues. The channel demonstrates a greater tendency to allow potassium to flow into the cell rather than out of it, a property known as inward rectification . This characteristic is crucial for establishing resting membrane potential and regulating excitability in cardiac myocytes. The inward rectification mechanism primarily results from blockage of outward current by internal magnesium . Additionally, the channel can be externally blocked by barium or cesium ions .

The voltage dependence of gpKCNJ2 is regulated by extracellular potassium concentration; as external potassium increases, the voltage range for channel opening shifts toward more positive voltages . This property allows the channel to dynamically respond to changes in the ionic environment, making it an essential regulator of action potential waveform and excitability in cardiac and neuronal tissues .

What genomic and molecular structures characterize gpKCNJ2?

The gpKCNJ2 gene has been fully sequenced and shows a unique genomic organization. While the coding region of gpKir2.1 is intronless (like gpKir2.2 and gpKir2.3), the gene contains at least one intron in the 5′ non-coding region . Specifically, the intronic sequence starts 217 bp upstream from the start codon and has a length of 4953 bp with conserved 3′ splice sites .

The cDNA of gpKir2.1 is 4047 bp long (accession number AF183914) and shows 90-94% homology to orthologous human or rat Kir2 cDNAs . This high degree of conservation suggests the importance of preserving channel function across species. The protein structure follows the typical Kir channel architecture with two transmembrane domains flanking a pore region, critical for ion selectivity and gating mechanisms.

What identification systems and synonyms exist for gpKCNJ2?

Researchers should be aware of multiple nomenclature systems when searching literature on gpKCNJ2:

  • Protein identifier: P52185

  • Gene name: Kcnj2

  • Taxonomic classification: Cavia porcellus (domestic guinea pig)

Common synonyms in the literature include:

  • Inward rectifier potassium channel 2

  • Cardiac inward rectifier potassium channel

  • Inward rectifier K(+) channel Kir2.1

  • IRK-1

  • Potassium channel, inwardly rectifying subfamily J member 2

Using these alternative identifiers can be crucial for comprehensive literature searches when researching gpKCNJ2.

How is gpKCNJ2 distributed among cardiac cell types?

Expression studies using multi-cell RT-PCR approaches have demonstrated that gpKir2.1, gpKir2.2, and gpKir2.3 (but not gpKir2.4) are expressed in cardiomyocytes . This cell-specific expression pattern is important for understanding the physiological roles of different Kir2 channel subunits in cardiac function.

Immunocytochemical analyses with polyclonal antibodies have further revealed that while gpKir2.1-2.3 are found in cardiomyocytes, gpKir2.4 expression is restricted to neuronal cells in the heart . This differential expression suggests specialized roles for each channel subtype within the cardiac environment.

How does gpKCNJ2 expression compare with other species?

Guinea pig myocytes express significantly higher levels of potassium currents compared to larger species . Both KCNQ1 and KCNH2 gene expression are significantly increased (p < 0.01) in guinea pig compared to larger species, suggesting that regulatory evolution of gene expression may contribute to species-specific differences in action potential duration .

This higher expression level in guinea pigs is likely an important factor contributing to the decreased action potential duration observed in these species compared to larger mammals . These differences highlight the importance of species selection when designing studies of cardiac electrophysiology.

What are the key electrophysiological characteristics of recombinant gpKCNJ2?

When expressed in heterologous systems, gpKCNJ2 demonstrates the classic properties of inward rectification. Studies comparing different guinea pig Kir2 channels suggest that gpKir2.1 corresponds to intermediate-conductance channels (approximately 23.8 pS) in native tissues . This conductance value helps identify the channel's contribution to total potassium current in physiological settings.

The channel's activation and deactivation kinetics are voltage-dependent, with the rectification behavior becoming more pronounced at membrane potentials positive to the potassium equilibrium potential. This rectification is physiologically significant as it allows the channel to contribute to maintaining resting membrane potential while minimizing interference with action potential generation.

How do the properties of recombinant gpKCNJ2 compare to native inward rectifier channels?

Comparative studies between cloned gpKir2 channels and native inward rectifier channels from guinea pig cardiac muscle have revealed important correlations. The large-conductance inward rectifier channels found in guinea pig cardiomyocytes (34.0 pS) appear to correspond to gpKir2.2, while the intermediate-conductance (23.8 pS) and low-conductance (10.7 pS) channels may correspond to gpKir2.1 and gpKir2.3, respectively .

Cell-attached recordings have shown that the concentration and voltage dependence of Ba²⁺ block of the large-conductance inward rectifier channels is virtually identical to that of gpKir2.2 expressed in Xenopus oocytes . These findings allow researchers to correlate recombinant channel properties with native currents, validating heterologous expression systems for functional studies.

How does gpKCNJ2 compare functionally to human KCNJ2?

Interestingly, comparative studies between guinea pig and human potassium channels have shown remarkable conservation of function. For the related KCNH2 channel, no detectable differences were found in the kinetic properties of human and guinea pig channels, with the two currents being indistinguishable in heterologous expression systems . This functional conservation suggests evolutionary pressure to maintain critical electrophysiological properties across species.

The main differences between guinea pig and human potassium channels appear to be quantitative (expression levels) rather than qualitative (functional properties), with guinea pigs showing higher expression levels that contribute to shorter action potential durations .

What are the optimal techniques for cloning gpKCNJ2?

Researchers have successfully cloned gpKCNJ2 using a combination of cDNA library screening and PCR-based approaches. Full-length cDNAs have been obtained by screening cDNA libraries from guinea pig cardiac ventricle . The following methodological approach has proven effective:

  • RNA extraction from guinea pig heart using modified single-step methods

  • cDNA fragment amplification using nested RT-PCR with degenerate primers

  • Screening of guinea pig cardiac cDNA libraries with the amplified fragments

  • Isolation and sequencing of full-length clones

For the nested PCR approach, researchers have successfully used the following primers:

  • First PCR:

    • Sense: 5′-GCNGAYATHTTYACNACNTGYGT-3′

    • Antisense: 5′-ACNGGYTCRWANCKRTGNCCCCA-3′

  • Nested PCR:

    • Sense: 5′-TGYYTNATGTGGMGNGTNGGNAA-3′

    • Antisense: 5′-CATNGCNGTNGCYTCNACCATNCC-3′

What expression systems are most suitable for gpKCNJ2 functional studies?

Xenopus laevis oocytes have proven to be an effective heterologous expression system for functional characterization of gpKCNJ2. The methodology typically involves:

  • Subcloning coding regions of gpKir2 cDNAs into polyadenylation transcription vectors (e.g., pSGEM)

  • Generating capped run-off poly(A)+ cRNA transcripts from linearized cDNAs

  • Injecting transcripts into defolliculated oocytes

  • Performing two-microelectrode voltage-clamp recordings after allowing sufficient time for expression

For voltage-clamp recordings, researchers typically use solutions containing (in mM): 60 KCl, 38 NaCl, 1.8 CaCl₂, 2 MgCl₂, 5 Hepes, titrated to pH 7.4 with NaOH at 20-22°C . This system allows for robust expression and reliable electrophysiological characterization of the channel.

What mutagenesis approaches are effective for studying gpKCNJ2 function?

Site-directed mutagenesis has been successfully employed to investigate specific functional domains of Kir2.1 channels. The QuikChange Site-Directed Mutagenesis kit (Stratagene) has been effective for introducing mutations into human Kir2.1, and similar approaches would apply to gpKCNJ2 .

Key mutations that have provided insights into channel function include:

  • V227F: A missense mutation found in patients with catecholaminergic polymorphic ventricular tachycardia (CPVT)

  • S425N: Mutation of the phosphorylation site at serine 425, which eliminates PKA-induced reduction in IK1

  • AAA: Mutation of the GYG pore sequence, which affects ion selectivity

These targeted mutations allow researchers to investigate structure-function relationships and regulatory mechanisms of the channel.

How does PKA-dependent phosphorylation affect gpKCNJ2 function?

PKA-dependent phosphorylation represents an important regulatory mechanism for Kir2.1 channels. Research on the V227F mutation in KCNJ2 has shown that PKA stimulation (using forskolin and IBMX to increase PKA activity) causes marked reduction of outward IK1 compared to wild-type channels .

This PKA-induced reduction in IK1 can be eliminated by mutating the phosphorylation site at serine 425 (S425N) . This finding suggests that PKA-dependent phosphorylation at S425 is a critical mechanism for regulating channel function, particularly during sympathetic stimulation. Researchers studying gpKCNJ2 should consider this regulatory mechanism when designing experiments, especially those investigating channel responses to adrenergic stimulation.

What is the effect of extracellular potassium on gpKCNJ2 function?

The voltage dependence of gpKCNJ2 is regulated by the concentration of extracellular potassium. As external potassium concentration increases, the voltage range for channel opening shifts toward more positive voltages . This property allows the channel to adjust its activity based on the extracellular ionic environment.

This phenomenon is particularly important in pathological conditions where extracellular potassium concentration may change, such as during ischemia or hyperkalemia. Researchers should carefully control extracellular potassium levels in experimental protocols when characterizing gpKCNJ2 function.

How do disease-associated mutations in KCNJ2 alter channel function?

Disease-associated mutations in KCNJ2 can dramatically alter channel function through various mechanisms. Unlike typical Andersen-Tawil Syndrome (ATS)-associated KCNJ2 mutations that show dominant-negative loss of function, some mutations like V227F yield currents indistinguishable from wild-type under basal conditions .

What experimental approaches can resolve contradictory findings regarding KCNJ2 mutations?

When investigating contradictory findings regarding KCNJ2 mutations, researchers should consider:

  • Physiological stimulation conditions: Testing channel function under both basal and stimulated conditions (e.g., PKA activation) may reveal phenotypes not evident under standard recording conditions .

  • Phosphorylation site mutagenesis: Creating mutations at known phosphorylation sites (e.g., S425N) can help determine if regulatory pathways are involved in mutation-associated dysfunction .

  • Co-expression with regulatory subunits: Some phenotypes may only become apparent when channels are co-expressed with physiologically relevant regulatory subunits.

  • Dynamic protocols: Using voltage protocols that mimic physiological action potentials rather than simple step protocols may reveal functional defects not apparent under standard testing conditions.

These approaches can help reconcile apparently contradictory findings and provide more physiologically relevant insights into channel dysfunction.

What are promising areas for future research on recombinant gpKCNJ2?

Several promising research directions for recombinant gpKCNJ2 include:

  • Heteromeric channel assembly: Further investigation into how gpKir2.1 assembles with other Kir2 family members to form heteromeric channels with unique properties.

  • Regulatory interactions: Identifying protein-protein interactions that modulate gpKCNJ2 function, including scaffolding proteins, kinases, and phosphatases.

  • Comparative genomics: Expanding the analysis of gpKCNJ2 regulatory regions to better understand species-specific expression patterns .

  • Computational modeling: Integrating gpKCNJ2 properties into computational models of guinea pig cardiac action potentials to understand species-specific electrophysiological properties.

These research directions could provide valuable insights into both the basic biology of inward rectifier channels and their role in cardiac pathophysiology.

How can discrepancies between recombinant and native channel properties be resolved?

Addressing discrepancies between recombinant and native channel properties requires systematic approaches:

  • Expression system optimization: Testing multiple expression systems beyond Xenopus oocytes, including mammalian cell lines that may provide more native-like cellular environments.

  • Co-expression with accessory subunits: Identifying and co-expressing auxiliary subunits that may modify channel properties in native tissues.

  • Post-translational modification: Investigating the role of glycosylation, phosphorylation, and other post-translational modifications that may differ between recombinant and native settings.

  • Temperature-dependent protocols: Conducting experiments at physiological temperatures rather than room temperature to capture temperature-dependent aspects of channel function.

These methodological refinements can help bridge the gap between heterologous expression systems and native cellular environments, providing more physiologically relevant insights into gpKCNJ2 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.