Recombinant Guinea pig Kappa-type opioid receptor (OPRK1)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Recombinant OPRK1 is typically expressed in heterologous systems such as COS-7 cells or cell-free expression platforms to enable high-yield purification . MyBioSource produces a transmembrane-domain-rich variant (UniProt: P34975) optimized for ligand-binding studies .

Table 2: Expression Systems and Applications

SystemApplicationBinding Affinity (Kd)
COS-7 cellsFunctional cAMP inhibition assaysDynorphin A: 0.8 nM
Cell-freeStructural studiesU-50,488: 2.1 nM
HEK293Signal transduction pathway analysisNor-BNI: 1.4 nM

Functional Characteristics

OPRK1 couples to Gαi/o proteins, inhibiting adenylyl cyclase activity and reducing intracellular cAMP levels . It also modulates voltage-gated calcium and potassium channels, influencing neuronal excitability .

Key Ligands:

  • Endogenous: Dynorphin peptides (high affinity: Kd=0.81.2 nMK_d = 0.8–1.2 \ \text{nM}) .

  • Synthetic: U-50,488 (κ-selective agonist), Nor-BNI (antagonist) .

Table 3: Pharmacological Profile

LigandFunctionIC₅₀ (cAMP Inhibition)Source
Dynorphin AAgonist3.5 nM
U-50,488Agonist5.2 nM
Nor-BNIAntagonist1.4 nM

Species-Specific Research Findings

  • Guinea Pig vs. Rodent OPRK1: The guinea pig receptor exhibits distinct ligand-binding specificity compared to rodents, with higher affinity for dynorphin analogs .

  • Tissue Distribution: OPRK1 mRNA is abundant in the cerebellum, brainstem, and spinal cord, correlating with its role in nociception .

Applications in Research

  • Pain Mechanisms: Used to study κ-opioid-mediated analgesia and tolerance .

  • Drug Development: Screens for κ-selective analgesics with reduced side effects (e.g., dysphoria) .

  • Comparative Biology: Highlights evolutionary divergence in opioid systems (e.g., reduced OPRK1 expression in avian species vs. mammals) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OPRK1; Kappa-type opioid receptor; K-OR-1; KOR-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV RNTVQDPAYMRNVDGVNKPV
Uniprot No.

Target Background

Function
The kappa-type opioid receptor (OPRK1) is a G-protein coupled receptor that binds endogenous alpha-neoendorphins and dynorphins, exhibiting low affinity for beta-endorphins. It also binds various synthetic opioids and the psychoactive diterpene salvinorin A. Ligand binding induces a conformational change, activating downstream signaling pathways via G proteins and modulating effectors such as adenylate cyclase. This signaling inhibits adenylate cyclase activity, suppresses neurotransmitter release by modulating calcium and potassium ion channels, and plays a crucial role in pain perception. Furthermore, OPRK1 mediates reduced physical activity in response to synthetic opioids, regulates salivation following synthetic opioid administration, and may contribute to arousal and autonomic/neuroendocrine function regulation.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of recombinant guinea pig OPRK1?

Recombinant guinea pig OPRK1 is a G protein-coupled receptor belonging to the 7 transmembrane-spanning receptor family . While specific guinea pig OPRK1 structural data is limited in the provided search results, related research indicates OPRK1 proteins typically contain critical extracellular, transmembrane, and intracellular domains necessary for ligand binding and signal transduction . Based on homology with other species, guinea pig OPRK1 likely contains multiple functional domains including an N-terminal extracellular region involved in ligand recognition, seven transmembrane segments that anchor the receptor in the cell membrane, and intracellular loops that mediate G-protein coupling . When expressed as a recombinant protein, guinea pig OPRK1 is commonly produced with affinity tags (such as His-tags) to facilitate purification and characterization .

How does the pharmacological profile of guinea pig OPRK1 compare to human and rodent OPRK1?

The correlation between OPRK1 binding and adenylyl cyclase inhibition varies across brain regions, with the cerebellum showing highest inhibition while it was absent in thalamus and superior colliculus . These regional differences may reflect variations in G-protein coupling efficiency or expression of downstream signaling components rather than receptor density differences alone .

What expression systems are most effective for producing recombinant guinea pig OPRK1?

Based on available research data, several expression systems have been employed for recombinant OPRK1 production across species, with varying advantages for specific research applications:

Expression SystemAdvantagesApplicationsReference
E. coliHigh yield, cost-effective, suitable for structural studiesProtein binding studies, antibody production
Mammalian cells (HEK293)Native-like post-translational modifications, proper foldingFunctional assays, cell signaling studies
Wheat germCell-free system allowing expression of toxic proteinsStructural studies, protein interaction studies

For guinea pig OPRK1 specifically, E. coli has been documented as an expression system for producing His-tagged recombinant protein . The choice of expression system should be guided by the specific research requirements, with mammalian expression systems generally preferred for functional studies due to their ability to provide proper post-translational modifications and membrane insertion .

How can researchers effectively investigate OPRK1-mediated adenylyl cyclase inhibition in guinea pig tissue?

Investigating OPRK1-mediated adenylyl cyclase inhibition in guinea pig tissue requires careful experimental design due to regional variations in coupling efficiency. Based on published methodologies, researchers should consider the following approach:

  • Tissue selection: Prioritize cerebellar membranes which show the highest levels of kappa-opioid-inhibited adenylyl cyclase activity compared to other brain regions .

  • Pharmacological characterization: Utilize selective kappa agonists such as U-50,488H to stimulate the receptor and measure subsequent adenylyl cyclase inhibition . Compare this with binding studies using radiolabeled ligands such as [³H]U-69,593 to establish correlation between binding affinity and functional response .

  • Receptor reserve evaluation: Employ irreversible antagonists like β-chlornaltrexamine (β-CNA) to deplete receptor populations incrementally and determine receptor reserve . As demonstrated in previous studies, β-CNA treatment of cerebellar kappa receptors blocks both kappa binding and kappa-inhibited adenylyl cyclase, with effects primarily on efficacy rather than potency, suggesting minimal receptor reserve for this effector system .

  • Regional comparisons: Include multiple brain regions in your analysis, as the relationship between receptor density and functional response varies significantly across brain regions . For instance, hippocampus exhibits high levels of kappa-inhibited adenylyl cyclase despite low binding levels, while cortex shows the opposite pattern .

This comprehensive approach allows for a more complete understanding of the complex relationship between OPRK1 binding and its functional effects on adenylyl cyclase across different brain regions.

What are the implications of OPRK1 knockout models for understanding receptor function?

OPRK1 knockout models provide valuable insights into the physiological roles of kappa opioid receptors. Research using these models has revealed important aspects of OPRK1 function that may inform studies using guinea pig OPRK1:

Targeted gene deletion approaches, such as those using Cre-lox recombination to ablate exon 3 of the OPRK1 gene, have generated both constitutive (KOR−/−) and conditional knockouts lacking KORs specifically in dopamine-containing neurons (DAT-KOR lox/lox) . These models have yielded several key findings:

  • Behavioral phenotypes: Constitutive KOR−/− mice appear normal in open field and light/dark box tests, suggesting possible compensatory adaptations after complete receptor ablation . In contrast, conditional DAT-KOR lox/lox mice show reduced anxiety-like behavior, consistent with the effects of KOR antagonists . This indicates that selective ablation of OPRK1 in specific neuronal populations may produce more targeted phenotypes than global receptor deletion.

  • Drug sensitivity: DAT-KOR lox/lox mice demonstrate exaggerated sensitization to the locomotor-stimulating effects of cocaine, supporting the role of KORs in negative regulation of dopamine function . The normal cocaine sensitization in KOR−/− mutants again suggests compensatory adaptations in constitutive knockouts .

  • Receptor validation: Autoradiography confirms complete ablation of KOR binding in constitutive KOR−/− mutants and reduced binding in conditional DAT-KOR lox/lox mutants, while qPCR confirms undetectable KOR mRNA in constitutive mutants and reduced expression in midbrain dopamine systems of conditional mutants .

These findings highlight the importance of considering both cell-type-specific and developmental factors when interpreting OPRK1 function. Similar approaches could be adapted for guinea pig models to elucidate species-specific aspects of OPRK1 function.

What are the optimal methods for validating antibodies against guinea pig OPRK1?

Validating antibodies against guinea pig OPRK1 requires multiple complementary approaches to ensure specificity and reliability. Based on established practices in OPRK1 research, the following validation strategy is recommended:

  • Western blot analysis with multiple tissues: Perform western blots using guinea pig brain lysates alongside positive controls from other species (mouse, rat, human) where the antibody is known to react . Include negative controls such as tissues known not to express OPRK1 or samples from knockout animals if available .

  • Blocking peptide controls: Pre-incubate the antibody with the immunizing peptide prior to application in western blot or immunohistochemistry . Complete abolishment of signal confirms specificity, as demonstrated with the κ-Opioid Receptor (OPRK1) extracellular antibody when pre-incubated with its blocking peptide .

  • Immunohistochemistry with anatomical validation: OPRK1 has known expression patterns in specific brain regions. For example, in rat, OPRK1 immunoreactivity is detected in cells and processes of the piriform cortex . Verify that guinea pig OPRK1 antibody staining matches expected anatomical distribution.

  • Flow cytometry for cell surface expression: For antibodies targeting extracellular epitopes, validate using flow cytometry on intact cells expressing OPRK1, as demonstrated with the OPRK1 extracellular antibody on live intact mouse J774 macrophage cells .

  • Cross-validation with multiple antibodies: When possible, use multiple antibodies targeting different epitopes of OPRK1 to confirm staining patterns and protein detection.

This comprehensive validation approach ensures reliable antibody performance for guinea pig OPRK1 detection across different experimental applications.

What are the critical considerations when designing binding studies for guinea pig OPRK1?

Designing rigorous binding studies for guinea pig OPRK1 requires careful attention to several methodological factors:

  • Ligand selection: Choose appropriate radioligands such as [³H]U-69,593 that demonstrate high affinity and selectivity for kappa opioid receptors . Consider the pharmacological properties of the ligand, including its selectivity profile across other opioid receptor subtypes.

  • Tissue preparation: Optimize membrane preparation protocols to preserve receptor integrity. Guinea pig brain membranes have been successfully used in previous studies, with regional variations in binding characteristics . Consider differential expression levels across brain regions when selecting tissue sources.

  • Assay conditions: Carefully control temperature, pH, ion concentrations, and protein levels, as these factors can significantly influence binding parameters. Document and maintain consistent conditions across experiments to ensure reproducibility.

  • Competition binding design: Include a range of competing ligands with varying selectivity profiles:

    Ligand TypeExamplesPurpose
    Selective κ agonistsU-50,488H, U-69,593Establish κ1 selectivity
    Endogenous opioidsDynorphin, α-neo endorphinCompare natural ligand affinity
    Antagonistsnor-BNI, β-chlornaltrexamineCharacterize receptor blockade
  • Correlation with functional assays: Perform parallel functional assays (e.g., adenylyl cyclase inhibition) to correlate binding affinity with functional efficacy . This is particularly important as previous studies have shown discrepancies between binding affinity and functional potency for some ligands, such as α-neo endorphin which demonstrated high binding affinity (Ki = 0.08 nM) but relatively weak adenylyl cyclase inhibition .

  • Data analysis: Apply appropriate mathematical models to determine binding parameters (Kd, Bmax, Ki values). Consider whether one-site or two-site binding models best fit your data, as this can reveal important information about receptor subtypes or states.

These methodological considerations will ensure the generation of reliable and reproducible binding data for guinea pig OPRK1.

How does guinea pig OPRK1 amino acid sequence compare to human and other model organisms?

While the search results don't provide the complete amino acid sequence comparison between guinea pig OPRK1 and other species, we can infer important information about sequence conservation and variation across species:

The human OPRK1 protein contains functional domains typical of G protein-coupled receptors, including an extracellular N-terminus, seven transmembrane domains, and intracellular regions for G-protein coupling . The search results indicate that human OPRK1 includes a recombinant fragment corresponding to amino acids 1-58 with an N-terminal proprietary tag, with a total molecular weight of approximately 32.01 kDa including tags .

For rat OPRK1, the peptide sequence NGSVGSEDQQLEPAHIS, corresponding to amino acid residues 39-55 of the extracellular N-terminus, has been used to generate antibodies that also recognize OPRK1 in mouse and human samples . This suggests conservation of this epitope across these species.

While specific guinea pig sequence information is limited in the provided search results, recombinant guinea pig OPRK1 proteins are commercially available (partial protein) , indicating sufficient sequence information exists to produce these reagents. The full-length recombinant guinea pig OPRK1 protein with His-tag is expressed in E. coli systems , suggesting its sequence is amenable to prokaryotic expression.

Based on general patterns of GPCR conservation, we would expect the transmembrane domains to show higher sequence conservation across species than the extracellular or intracellular loops, which often exhibit more variation. This has implications for designing cross-reactive tools such as antibodies or ligands for comparative studies.

What are the functional differences in signaling pathways between guinea pig OPRK1 and other species?

Research on OPRK1 signaling pathways reveals important species-specific differences that researchers should consider when using guinea pig models:

  • Adenylyl cyclase inhibition: Guinea pig OPRK1 exhibits regional variations in adenylyl cyclase inhibition that may differ from other species . In guinea pig brain, kappa-opioid-inhibited adenylyl cyclase activity is highest in the cerebellum, absent in thalamus and superior colliculus, and moderate in other regions . These regional patterns may not directly translate to other species due to differences in receptor distribution or G-protein coupling efficiency.

  • Regional correlation of binding and function: The relationship between receptor density and functional response varies across brain regions in guinea pig . Notably, guinea pig hippocampus shows high levels of kappa-inhibited adenylyl cyclase despite low levels of kappa binding, while cortex exhibits high density of kappa sites but relatively low levels of kappa-inhibited adenylyl cyclase . These discrepancies suggest region-specific differences in signaling efficiency that may be species-dependent.

  • Receptor reserve: Studies using β-chlornaltrexamine (β-CNA) to irreversibly block cerebellar kappa receptors in guinea pig suggest no significant receptor reserve for adenylyl cyclase inhibition . This pharmacological property may differ in other species and could impact the interpretation of dose-response relationships in comparative studies.

  • Dopaminergic regulation: While not specific to guinea pig, OPRK1 plays an important role in negatively regulating mesolimbic dopamine neurons . Knockout studies in mice reveal that selective ablation of OPRK1 in dopamine neurons (DAT-KOR lox/lox) leads to exaggerated cocaine sensitization, supporting OPRK1's role in dopamine regulation . Researchers should consider potential species differences in these regulatory mechanisms when translating findings between rodent models.

Understanding these species-specific signaling characteristics is crucial for appropriately interpreting experimental results and translating findings between model systems in OPRK1 research.

What are the optimal storage and handling conditions for recombinant guinea pig OPRK1?

Proper storage and handling of recombinant OPRK1 proteins is critical for maintaining functionality and experimental reproducibility. Based on established protocols for recombinant proteins similar to OPRK1, the following guidelines are recommended:

  • Shipping and receiving: Recombinant OPRK1 proteins are typically shipped on dry ice . Upon receipt, immediately transfer to appropriate long-term storage conditions without allowing the material to thaw.

  • Long-term storage: Store recombinant OPRK1 at -80°C for maximum stability . Avoid repeated freeze-thaw cycles which can lead to protein denaturation and activity loss.

  • Working solution preparation: When preparing working solutions, aliquot the stock protein into single-use volumes to avoid repeated freeze-thaw cycles . For reconstitution or dilution, use buffers specified by the manufacturer, which typically maintain physiological pH (around 8.00) and may contain stabilizing agents such as glutathione .

  • Buffer composition: Typical storage buffers for recombinant OPRK1 contain components that maintain protein stability, such as:

    • pH buffering agents (e.g., Tris HCl at pH 8.00)

    • Reducing agents (e.g., 0.3% Glutathione)

    • In some cases, protease inhibitors to prevent degradation

  • Working temperature: For functional assays, gradually warm the protein to the appropriate experimental temperature (typically room temperature or 37°C) immediately before use. Avoid prolonged exposure to temperatures above 4°C when not in use.

Following these guidelines will help ensure the integrity and functionality of recombinant guinea pig OPRK1 preparations for experimental applications.

What approaches are most effective for measuring OPRK1 expression levels in guinea pig tissues?

Accurate quantification of OPRK1 expression in guinea pig tissues requires selection of appropriate methodologies based on experimental objectives:

  • Quantitative PCR (qPCR): For mRNA expression analysis, qPCR provides a sensitive method for quantifying OPRK1 transcript levels. This approach has been successfully used to confirm knockout of OPRK1 in genetic models, demonstrating its sensitivity for detecting expression changes . When designing primers for guinea pig OPRK1, ensure specificity by targeting conserved regions confirmed by sequence alignment with other species.

  • Receptor autoradiography: This technique provides spatial information about receptor distribution and density using radiolabeled ligands such as [³H]U-69,593 . Autoradiography has successfully demonstrated complete ablation of KOR binding in knockout models and can detect regional variations in receptor density across brain regions . For guinea pig tissues, optimize incubation conditions and washing steps to maximize signal-to-noise ratio.

  • Western blotting: Using validated antibodies against OPRK1, western blotting can quantify protein expression levels . When analyzing guinea pig samples, include appropriate positive controls (e.g., brain lysates from other species with confirmed antibody reactivity) and negative controls (tissues known not to express OPRK1) .

  • Immunohistochemistry: This approach provides cellular and subcellular localization information about OPRK1 expression . Validation with blocking peptides is essential to confirm antibody specificity, as demonstrated with OPRK1 extracellular antibodies in rat piriform cortex sections .

  • Flow cytometry: For cell surface expression of OPRK1, flow cytometry using antibodies targeting extracellular epitopes can provide quantitative data on receptor density per cell . This approach is particularly useful for cultured cells expressing recombinant guinea pig OPRK1.

Each of these methodologies has specific strengths and limitations. Combining multiple approaches provides the most comprehensive assessment of OPRK1 expression in guinea pig tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.