Recombinant Guinea pig Mu-type opioid receptor (OPRM1)

What is the Guinea pig Mu-type opioid receptor (OPRM1) and why is it used in research?

The Guinea pig Mu-type opioid receptor (OPRM1) is a G-protein-coupled receptor encoded by the OPRM1 gene. It serves as the primary binding site for endogenous opioid peptides and exogenous opioid drugs. Guinea pig OPRM1 is valuable in research due to the unique phylogenetic bifurcation of guinea pigs, which results in varying degrees of homology with human proteins. This makes guinea pig OPRM1 useful in comparative studies of opioid receptor function across species and potentially valuable for developing human-relevant models of opioid action .

How is recombinant Guinea pig OPRM1 protein typically produced?

Recombinant Guinea pig OPRM1 protein is commonly expressed in E. coli expression systems. The full-length protein (in some commercial preparations consisting of amino acids 1-98) is typically fused to a tag such as His-tag to facilitate purification. The protein is expressed in bacterial systems, purified, and then lyophilized for storage. The amino acid sequence (YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI) contains key domains important for ligand binding and receptor function .

What are the optimal storage conditions for recombinant OPRM1 proteins?

For optimal preservation of recombinant OPRM1 protein activity, the following storage conditions are recommended:

• Store lyophilized powder at -20°C/-80°C upon receipt

• After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

• Short-term working aliquots can be stored at 4°C for up to one week

• For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol (final concentration 5-50%, with 50% being standard) to samples for long-term storage at -20°C/-80°C

How can I confirm the purity and identity of recombinant Guinea pig OPRM1 protein?

Verification of recombinant Guinea pig OPRM1 purity and identity typically involves multiple analytical approaches:

Additionally, researchers should verify the amino acid sequence against the UniProt database entry (P97266) for Guinea pig OPRM1 .

How do binding profiles of opioid ligands differ between Guinea pig OPRM1 and human MOR?

The binding profiles of opioid ligands to Guinea pig OPRM1 compared to human MOR exhibit both similarities and key differences that are important for translational research. Molecular dynamics (MD) simulations and structural studies have revealed that ligands like morphine and fentanyl interact differently with the receptor binding pocket.

Morphine typically induces a gauche− conformation (χ1 dihedral angle <115.0°) of the Asp149³·³² residue (equivalent position in human MOR), positioning the sidechain away from TM2. In contrast, fentanyl predominantly promotes a trans conformation of this residue, bringing it within closer hydrogen-bonding distance to Tyr328⁷·⁴³ on TM7 .

These conformational differences influence:

• Receptor activation efficiency

• Biased signaling properties

• Development of tolerance

• Side effect profiles

When designing experiments using Guinea pig OPRM1, researchers should account for these species-specific differences in receptor-ligand interactions, especially when extrapolating findings to human applications .

What experimental approaches can differentiate between MOR-dependent and MOR-independent effects in opioid-induced hyperalgesia studies?

Distinguishing MOR-dependent from MOR-independent effects in opioid-induced hyperalgesia (OIH) studies requires multiple complementary approaches:

• Genetic approach: Compare wild-type (WT) and MOR knockout (KO) models

  • Studies show that repeated morphine administration leads to analgesic tolerance and hyperalgesia in WT mice but not in MOR KO mice

  • This effect is consistent across both sexes and different pain modalities (mechanical, heat, cold)

• Pharmacological approach: Use selective MOR antagonists versus broad-spectrum antagonists

  • Compare effects of selective μ-antagonists (e.g., CTAP) with non-selective antagonists

• Metabolite studies: Analyze effects of morphine metabolites

  • Morphine-3beta-D-glucuronide (M3G) elicits hyperalgesia in WT but not in MOR KO animals

  • M3G displays significant binding to MOR and induces G-protein activation with membranes from MOR-expressing tissues but not from MOR KO tissues

• Conditional knockout models: Target specific cell populations

  • MOR-Nav1.8 sensory neuron conditional KO mice can help identify cell type-specific contributions to OIH

These approaches collectively demonstrate that MOR is required for the development of hyperalgesia induced by chronic morphine and its metabolite M3G, allowing researchers to distinguish receptor-specific effects from other mechanisms .

What methodological considerations are important when using Guinea pig OPRM1 for binding assays with various opioid ligands?

When conducting binding assays with Guinea pig OPRM1 and opioid ligands, several methodological considerations are crucial:

• Membrane preparation:

  • Use freshly prepared membrane fractions from cells expressing recombinant Guinea pig OPRM1

  • Ensure consistent protein concentration across experiments (typically 5-50 μg protein per assay)

• Buffer composition:

  • Tris/PBS-based buffers (pH 7.4-8.0) are typically optimal

  • Include protease inhibitors to prevent protein degradation

  • Consider adding reducing agents to maintain disulfide bonds

• Ligand selection and concentration range:

  • Use a wide concentration range (10⁻¹⁰ to 10⁻⁵ M) to construct complete competition curves

  • Include standard compounds (morphine, DAMGO) as reference ligands

  • Account for different binding kinetics (equilibration times may vary from 30 min to 2 hours)

• Controls and validation:

  • Include non-specific binding controls (using excess cold ligand)

  • Validate assay with known agonists and antagonists

  • Consider allosteric effects that may influence binding kinetics

• Data analysis considerations:

  • Use appropriate curve-fitting models (one-site vs. two-site binding)

  • Convert IC₅₀ values to Ki using the Cheng-Prusoff equation

  • Account for potential species differences when comparing to human data

How can Guinea pig OPRM1 be used in structural studies to elucidate agonist efficacy mechanisms?

Guinea pig OPRM1 offers valuable insights into agonist efficacy mechanisms through structural studies employing the following methodologies:

• Homology modeling and molecular dynamics (MD) simulations:

  • Generate homology models based on crystallized MOR structures

  • Perform long-timescale MD simulations (3+ μs) to assess conformational stability

  • Compare ligand-specific effects on receptor dynamics

  • Analyze key interactions like those between Asp149³·³² and Tyr328⁷·⁴³

• Binding pose analysis:

  • Dock various agonists (e.g., morphine, fentanyl) into the binding pocket

  • Calculate root mean square deviation (RMSD) to evaluate stability of binding poses

  • Compare with antagonist binding (e.g., naltrexone) to identify efficacy determinants

  • Analyze transmembrane helical movements associated with receptor activation

• Site-directed mutagenesis:

  • Introduce mutations at key residues identified in structural models

  • Measure effects on ligand binding affinity and receptor activation

  • Construct chimeric receptors to isolate domains responsible for species-specific responses

• Conformational analysis:

  • Monitor dihedral angle distributions of key residues like Asp149³·³²

  • Identify conformational states (gauche− vs. trans) associated with different ligands

  • Correlate structural changes with functional effects

The data from these studies reveal that different opioid ligands induce distinct conformational states in OPRM1, which may explain differences in efficacy, side effect profiles, and the development of tolerance .

What approaches can be used to compare antibody specificity between Guinea pig anti-OPRM1 antibodies and those from other species?

When evaluating the specificity of Guinea pig anti-OPRM1 antibodies compared to those from other species, researchers should implement the following comprehensive approaches:

• Cross-reactivity testing:

  • Test antibodies against OPRM1 from multiple species (human, rat, mouse, guinea pig)

  • Use Western blots with recombinant proteins and tissue lysates

  • Compare band patterns to identify species-specific recognition

• Epitope mapping:

  • Identify the specific epitope(s) recognized by each antibody

  • Compare epitope conservation across species

  • Use peptide arrays or overlapping peptide libraries to pinpoint binding regions

• Multiplexed immunostaining:

  • Perform simultaneous staining with antibodies from different host species

  • Verify co-localization patterns in tissues known to express OPRM1

  • Confirm specificity using knockout tissue/cells as negative controls

• Blocking experiments:

  • Pre-absorb antibodies with the immunizing peptide

  • Compare signal reduction to assess specific binding

  • Cross-block with peptides from different species' OPRM1 sequences

• Functional validation:

  • Use antibodies in functional assays (receptor internalization, signaling)

  • Compare effects on receptor function across species

  • Correlate antibody binding with functional outcomes

Guinea pig antibodies offer unique advantages in multiplex experimental designs due to their phylogenetic distance from commonly used rabbits and mice, allowing simultaneous detection of multiple targets without cross-reactivity between secondary antibodies .

How can functional assays be optimized to compare signaling bias of different ligands at Guinea pig OPRM1?

Optimizing functional assays to evaluate signaling bias of different ligands at Guinea pig OPRM1 requires a systematic approach addressing multiple aspects of receptor signaling:

• G-protein coupling assays:

  • [³⁵S]GTPγS binding assays using membranes expressing Guinea pig OPRM1

  • BRET/FRET-based assays measuring G-protein activation in real-time

  • Compare efficacy and potency across Gαi/o, Gαs and Gαq pathways

  • Normalize data to a reference full agonist like DAMGO

• β-arrestin recruitment:

  • Enzyme complementation assays (PathHunter®)

  • BRET-based assays with tagged β-arrestin and receptor

  • Compare recruitment kinetics for arrestin-1 vs. arrestin-2

  • Assess differences in transient vs. sustained recruitment

• Downstream signaling:

  • Measure cAMP inhibition (for Gαi pathway)

  • Quantify ERK1/2 phosphorylation (which can occur via G-protein or arrestin)

  • Compare calcium mobilization (for Gαq coupling)

  • Assess kinetics to distinguish rapid (G-protein) vs. delayed (arrestin) phases

• Receptor trafficking:

  • Internalization assays using fluorescently-tagged receptors

  • Recycling vs. degradation fate after endocytosis

  • Correlation between internalization and desensitization

• Bias quantification:

  • Calculate bias factors using operational model

  • Compare concentration-response curves between pathways

  • Use reference ligands to establish system bias

  • Apply appropriate statistical analysis for bias determination

This comprehensive approach can reveal how different ligands (morphine, fentanyl, etc.) preferentially activate specific signaling pathways downstream of Guinea pig OPRM1, potentially explaining differences in therapeutic effects and adverse outcomes .

What advantages do Guinea pig models offer for studying OPRM1 compared to rodent models?

Guinea pig models provide several distinct advantages for OPRM1 research compared to traditional rodent models:

• Phylogenetic positioning:

  • Guinea pigs have a unique phylogenetic bifurcation that creates varying degrees of homology with human proteins

  • This evolutionary distance can make guinea pigs suitable for generating antibodies against human proteins that might be too conserved in mice or rats

• Immunological properties:

  • Guinea pigs typically mount stronger antibody responses to antigens compared to mice or rats

  • This heightened immunogenicity allows for efficient antibody production using less antigen

• Experimental flexibility:

  • Guinea pig antibodies enable more complex multiplex experimental designs

  • When using multiple antibodies from different species (guinea pig, rabbit, mouse), researchers can avoid cross-reactivity issues in secondary antibody detection systems

• Physiological relevance:

  • Guinea pigs may better model certain aspects of human opioid pharmacology

  • Metabolic pathways for opioids in guinea pigs can more closely resemble human metabolism in some respects than those in mice or rats

When designing experiments, researchers should consider these advantages while acknowledging potential limitations in genetic manipulation tools compared to mouse models .

What methodological approaches can be used to validate Guinea pig OPRM1 as a model for human opioid receptor pharmacology?

Validating Guinea pig OPRM1 as a model for human opioid receptor pharmacology requires multiple complementary approaches:

• Sequence and structural comparison:

  • Perform detailed alignment of Guinea pig and human OPRM1 amino acid sequences

  • Identify conservation in critical binding domains and signaling interfaces

  • Create homology models to compare predicted structures

  • Focus on key residues known to interact with ligands or transduction proteins

• Pharmacological profiling:

  • Compare binding affinity (Ki values) of a diverse panel of opioid ligands

  • Assess rank order potency correlations between species

  • Measure functional responses (EC50 and Emax) across multiple signaling pathways

  • Identify species-specific pharmacological differences for clinically relevant compounds

• Signaling mechanism comparisons:

  • Evaluate G-protein coupling preferences between species

  • Compare β-arrestin recruitment kinetics and efficacy

  • Assess receptor phosphorylation patterns

  • Measure receptor internalization and recycling dynamics

• Physiological response correlation:

  • Develop comparable behavioral assays between species where possible

  • Compare analgesic dose-response relationships

  • Assess development of tolerance and dependence

  • Measure respiratory depression and other side effects

  • Correlate in vitro findings with in vivo outcomes

• Statistical validation approaches:

  • Perform inter-species concordance analysis

  • Apply weighted kappa statistics for categorical responses

  • Calculate correlation coefficients for continuous parameters

  • Develop predictive models based on multiple parameters

This comprehensive validation approach can establish which aspects of human OPRM1 pharmacology are accurately modeled by Guinea pig OPRM1 and identify limitations that must be considered when extrapolating findings .

What are common challenges when working with recombinant OPRM1 proteins and how can they be addressed?

Researchers working with recombinant OPRM1 proteins frequently encounter several challenges that can be systematically addressed:

For recombinant Guinea pig OPRM1 specifically, researchers should verify the amino acid sequence against the reference (P97266) and confirm protein integrity before functional studies .

How can researchers optimize immunodetection methods for Guinea pig OPRM1 in various experimental contexts?

Optimizing immunodetection of Guinea pig OPRM1 across different experimental platforms requires careful consideration of several factors:

• Western Blotting optimization:

  • Sample preparation: Use appropriate detergents (e.g., CHAPS, DDM) for membrane protein extraction

  • Denaturation: Test both reducing and non-reducing conditions as disulfide bonds may affect epitope exposure

  • Transfer conditions: Use extended transfer times (2-3h) or specialized methods for membrane proteins

  • Blocking: Test different blockers (milk vs. BSA) as they may differently affect background

  • Validation: Include positive controls (recombinant protein) and negative controls

• Immunohistochemistry/Immunofluorescence:

  • Fixation: Compare paraformaldehyde vs. methanol fixation effects on epitope accessibility

  • Antigen retrieval: Optimize pH and temperature for epitope unmasking

  • Permeabilization: Test different detergents (Triton X-100, saponin) at various concentrations

  • Detection systems: Compare tyramide signal amplification vs. standard secondary detection

  • Confocal settings: Optimize laser power and detection settings to avoid saturation

• Flow cytometry:

  • Live vs. fixed cell protocols: Develop protocols for surface vs. total receptor detection

  • Staining buffers: Include sodium azide to prevent receptor internalization during staining

  • Controls: Use fluorescence minus one (FMO) and isotype controls

  • Gating strategy: Develop consistent gating approach for receptor-expressing populations

• Guinea pig-specific considerations:

  • Secondary antibodies: Ensure secondary antibodies are specifically validated for guinea pig immunoglobulins

  • Cross-reactivity: Test for potential cross-reactivity with other opioid receptor subtypes

  • Signal amplification: Consider biotin-streptavidin systems for enhanced sensitivity

Through systematic optimization of these parameters, researchers can develop robust protocols for specific and sensitive detection of Guinea pig OPRM1 across multiple experimental platforms .

How might comparative studies of Guinea pig and human OPRM1 advance our understanding of biased signaling in opioid receptor pharmacology?

Comparative studies of Guinea pig and human OPRM1 offer promising avenues to advance our understanding of biased signaling in opioid receptor pharmacology through several innovative approaches:

• Species-specific signaling fingerprints:

  • Systematically compare G-protein vs. β-arrestin recruitment profiles across species

  • Identify residues responsible for species differences in signaling bias

  • Correlate structural differences with functional outcomes

  • Develop predictive models of ligand bias based on receptor sequence/structure

• Evolutionary insights into receptor function:

  • Trace the evolutionary divergence of OPRM1 sequences across species

  • Identify conserved vs. variable regions associated with specific signaling pathways

  • Use ancestral sequence reconstruction to understand the evolution of biased signaling

  • Correlate receptor evolution with species-specific physiological needs

• Translational implications:

  • Determine how species differences in signaling bias affect in vivo outcomes

  • Identify which aspects of Guinea pig OPRM1 signaling better predict human responses

  • Develop improved preclinical models for predicting therapeutic vs. adverse effects

  • Guide design of novel biased ligands with optimized clinical profiles

• Advanced methodological approaches:

  • Apply CRISPR/Cas9 editing to create humanized Guinea pig OPRM1 receptors

  • Develop novel biosensors to detect pathway-specific conformational changes

  • Utilize phosphoproteomics to map species differences in receptor phosphorylation patterns

  • Employ cryo-EM to capture species-specific receptor conformations with various ligands

These comparative studies could ultimately lead to better prediction of human responses to novel opioid ligands and guide the development of safer, more effective analgesics with reduced side effect profiles .

What are the most promising applications of recombinant Guinea pig OPRM1 in drug discovery and development?

Recombinant Guinea pig OPRM1 offers several promising applications in opioid drug discovery and development:

• Screening platforms for novel ligands:

  • High-throughput screening assays using recombinant Guinea pig OPRM1

  • Parallel screening against human and Guinea pig OPRM1 to identify broadly active compounds

  • Development of cell-based reporter assays for pathway-specific activation

  • Biosensor applications for real-time monitoring of receptor conformational changes

• Structure-based drug design:

  • Generation of homology models for virtual screening campaigns

  • Identification of species-conserved binding pockets for rational drug design

  • Development of compounds with predictable cross-species activity profiles

  • Design of biased ligands targeting specific receptor conformations

• Predictive toxicology applications:

  • Development of in vitro systems to predict adverse effects

  • Correlation of Guinea pig OPRM1 activation patterns with side effect profiles

  • Establishment of safety margins based on comparative pharmacology

  • Creation of multiplexed assays measuring multiple signaling endpoints simultaneously

• Translational model development:

  • Validation of Guinea pig models for specific aspects of opioid pharmacology

  • Development of humanized Guinea pig OPRM1 variants

  • Creation of transgenic systems expressing human OPRM1 variants in Guinea pig backgrounds

  • Refinement of in vitro-in vivo correlation models across species

• Production of novel research tools:

  • Development of conformationally selective antibodies

  • Creation of labeled ligands for binding and imaging studies

  • Production of purified receptor proteins for structural studies

  • Engineering of chimeric receptors to isolate functionally important domains

These applications could significantly accelerate the development of improved opioid analgesics with enhanced safety profiles and reduced potential for misuse and dependence .