Recombinant Guinea pig Neuropeptide Y receptor type 1 (NPY1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag based on your needs.
Synonyms
NPY1R; Neuropeptide Y receptor type 1; NPY1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MNSTSFSQLENHSVHYNLSEEKPSFFAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLA LILIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWIFGEIMCKLNPFVQ CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGIAVIWVLAVASSLPFMIYQVLT DEPFQNVTLDAFKDKLVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR RNNMMDKMRDSKYRSSESKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS KTSLKQASPLAFKKISCVENEKI
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural homology between guinea pig NPY1R and other mammalian orthologs?

Guinea pig NPY1R has been cloned and characterized, showing 92-93% sequence identity to other mammalian Y1 receptors. This high degree of conservation indicates the evolutionary importance of this receptor across mammalian species. The guinea pig NPY1R demonstrates similar pharmacological properties to its orthologs in other mammals, making it an excellent model for comparative studies .

What is the binding profile of various ligands to recombinant guinea pig NPY1R?

Binding studies have demonstrated that porcine NPY and peptide YY (PYY) display exceptionally high affinities for guinea pig NPY1R with Ki values of 43 pM and 48 pM, respectively. In contrast, truncated peptides show reduced binding: NPY2-36 has 6-fold lower affinity while NPY3-36 demonstrates 46-fold lower affinity compared to intact NPY. This pharmacological profile helps define the structural requirements for high-affinity binding to NPY1R .

How does the functional coupling of guinea pig NPY1R compare to ligand binding profiles?

Functional coupling studies using microphysiometry reveal that human NPY and PYY demonstrate equipotent activity in causing extracellular acidification with EC50 values of 0.59 nM and 0.69 nM, respectively. The truncated peptides show dramatically reduced functional potency, with NPY2-36 being approximately 15-fold less potent and NPY3-36 being approximately 500-fold less potent than full-length NPY. This functional hierarchy mirrors but does not exactly match the binding affinities, suggesting complex transduction mechanisms following receptor occupancy .

What is the cellular distribution of NPY1R in the guinea pig nervous system?

Research using advanced genetic labeling techniques has revealed that 78.4% of glutamatergic neurons in the inferior colliculus (IC) express Npy1r mRNA. These Y1R-positive neurons can co-express other neuropeptides including vasoactive intestinal peptide (VIP) and/or cholecystokinin (CCK). Importantly, Y1R+ neurons form dense interconnections within local IC circuits, providing extensive excitatory inputs to other neurons in this auditory processing center .

What methodologies are most effective for detecting NPY1R expression in experimental systems?

Multiple complementary approaches should be employed for comprehensive NPY1R detection:

  • RT-PCR: Effective for determining transcription levels in tissue homogenates, as demonstrated in studies of lymph node cells and spleen T cells .

  • Real-time PCR: Provides quantitative measurement using systems like the Light Cycler, allowing precise determination of expression levels .

  • In situ hybridization: Enables visualization of mRNA in specific cell populations within intact tissue architecture .

  • Transgenic reporter systems: Y1R-Cre x Ai14 mouse models that express fluorescent proteins (tdTomato) in Y1R+ neurons offer powerful tools for identifying and characterizing receptor-expressing cells .

What selective agonists and antagonists are available for studying guinea pig NPY1R?

Several pharmacological tools have been validated for guinea pig NPY1R research:

Agonists:

  • Porcine/human NPY (high affinity: 43 pM)

  • Peptide YY (PYY) (high affinity: 48 pM)

  • [Leu31, Pro34]-NPY (LP-NPY): Y1R-selective agonist shown to hyperpolarize Y1R+ neurons

Antagonists:

  • BIBO 3304: Highly selective Y1 antagonist (Ki = 1.1±0.2 nM) with minimal activity at Y2/Y5 receptors

  • H 409/22: Selective Y1 antagonist (Ki = 5.6±0.9 nM)

The availability of these selective tools enables precise interrogation of NPY1R function in complex biological systems .

How can researchers effectively design functional assays for recombinant guinea pig NPY1R?

Optimal functional assay design for guinea pig NPY1R should consider:

  • Microphysiometry: Measures extracellular acidification rates following receptor activation, providing a robust readout of functional coupling .

  • Electrophysiological approaches: Whole-cell patch clamp recordings enable direct measurement of Y1R-mediated hyperpolarization in neurons expressing the receptor .

  • Second messenger assays: Measurement of G-protein coupling through GTPγS binding, cAMP inhibition, or calcium mobilization assays can provide complementary functional data.

  • Optogenetic integration: Combining optogenetic stimulation with electrophysiological recording in Y1R-Cre transgenic models allows precise spatiotemporal control when studying circuit-level functions .

How does NPY1R contribute to feeding regulation in guinea pigs compared to other species?

The guinea pig represents an important evolutionary perspective in NPY receptor research, as this species is almost equally distantly related to rodents and humans. Studies demonstrate that NPY stimulates feeding in guinea pigs through both Y1 and Y5 receptors. When guinea pigs were pretreated with Y1 receptor antagonists BIBO 3304 or H 409/22, the feeding response to NPY was inhibited. Similarly, the Y5 antagonist CGP 71683A attenuated NPY-induced feeding .

This dual receptor involvement contrasts with earlier debates in rodent models that initially proposed Y1 as the primary "feeding receptor" but later focused on Y5. The guinea pig data suggests both receptors mediate feeding across diverse mammalian orders, providing an evolutionary perspective that may better predict the situation in humans .

ReceptorAntagonistKi ValueEffect on NPY-Induced Feeding
Y1BIBO 33041.1±0.2 nMInhibition
Y1H 409/225.6±0.9 nMInhibition
Y5CGP 71683A1.3±0.05 nMAttenuation

What role does NPY1R play in neurological autoimmune disorders?

NPY1R has demonstrated significant immunomodulatory potential in experimental autoimmune encephalomyelitis (EAE), an animal model of multiple sclerosis. Exogenous NPY and Y1 receptor-specific agonists significantly inhibit EAE induction, while Y5 receptor agonists fail to provide protection. The mechanisms involve:

  • Direct modulation of T-cell responses: Y1 receptor activation inhibits myelin-specific Th1 responses and promotes a Th2 bias in autoimmune T cells.

  • Endogenous protective pathway: Y1 receptor antagonists accelerate EAE onset, indicating that endogenous NPY provides protection during disease induction.

  • Direct action on immune cells: Ex vivo analyses confirm that autoimmune T cells express functional Y1 receptors and are directly affected by NPY signaling .

These findings suggest NPY1R as a potential therapeutic target for Th1-mediated autoimmune neurological conditions.

How does NPY1R contribute to auditory processing in the inferior colliculus?

Recent research using Y1R-Cre x Ai14 transgenic models has revealed that NPY1R plays important roles in auditory processing:

  • The majority (78.4%) of glutamatergic neurons in the inferior colliculus express NPY1R, suggesting widespread involvement in auditory processing.

  • Y1R+ neurons form dense interconnections within local circuits, providing extensive excitatory inputs to other neurons in the IC.

  • Application of the Y1R agonist [Leu31, Pro34]-NPY (LP-NPY) hyperpolarizes Y1R+ neurons, indicating that NPY signaling modulates neuronal excitability in auditory circuits.

  • This neuropeptide signaling may regulate auditory processing across spatial and temporal scales not achievable with conventional GABAergic signaling alone .

How do genetic variations in NPY1R influence cardiovascular function?

Research on NPY1R genetic variations has identified several functionally significant polymorphisms with implications for cardiovascular health:

  • A common variant in the 3′-UTR (A+1050G) influences autonomic traits including baroreceptor function and blood pressure responses to environmental stress.

  • The 3′-UTR A+1050G and promoter A-585T variants interact to determine blood pressure in populations with extreme BP values.

  • Functional studies show that these variants affect NPY1R expression through both transcriptional and post-transcriptional mechanisms:

    • The 3′-UTR +1050G variant disrupts a microRNA binding motif

    • The promoter A-585 variant decreases expression in reporter assays

  • The alleles that increased blood pressure in vivo (3′-UTR +1050G, promoter A-585) also decreased NPY1R expression in cellular models .

These findings establish NPY1R as a genetic factor in autonomic cardiovascular control with potential clinical relevance for hypertension diagnosis and treatment strategies.

What insights can be gained from comparing guinea pig NPY1R with other mammalian species?

The guinea pig offers valuable evolutionary perspectives in NPY1R research:

  • Phylogenetic positioning: Guinea pigs are almost equally distantly related to rodents and humans based on DNA analysis, making them complementary to traditional rodent models .

  • Receptor conservation: The 92-93% sequence identity between guinea pig NPY1R and other mammalian orthologs indicates strong evolutionary pressure to maintain this receptor's structure and function .

  • Pharmacological similarity: Guinea pig NPY1R displays binding and functional profiles similar to human receptors, supporting translational relevance .

  • Y5 receptor similarity: Unlike rat Y5, the guinea pig Y5 receptor shows higher amino acid identity to the human Y5 receptor and virtually identical pharmacological profiles .

  • Y receptor gene evolution: While y6 is functional in mice, it exists as a pseudogene in primates and guinea pigs, and is absent in rats, highlighting different evolutionary trajectories within the NPY receptor family .

These comparative insights can guide appropriate model selection for translational studies and enhance understanding of NPY system evolution across mammalian species.

How can recombinant NPY1R be leveraged for drug discovery applications?

Recombinant guinea pig NPY1R provides several advantages for drug discovery:

  • High homology to human receptor (92-93% identical), suggesting good translational potential for identified compounds .

  • Well-characterized pharmacology with multiple validated assay systems, including:

    • High-affinity binding assays (demonstrated pM affinities for natural ligands)

    • Functional assays (microphysiometry with nM EC50 values)

    • Tissue-specific expression data for targeting specific physiological systems .

  • Therapeutic potential across multiple disease areas:

    • Feeding disorders and obesity (via Y1/Y5 regulation of food intake)

    • Autoimmune conditions (immunomodulatory effects on T cells)

    • Cardiovascular disorders (impact on autonomic regulation)

    • Neurological functions (modulation of auditory processing)

  • Availability of selective pharmacological tools (agonists and antagonists) that can serve as positive controls or starting points for medicinal chemistry optimization .

Researchers should employ orthogonal assay systems and validate findings across multiple experimental paradigms to maximize translational relevance.

What considerations are important when designing gene modification studies targeting NPY1R?

When designing gene modification studies for NPY1R research, consider:

  • Compensatory mechanisms: Gene knockout studies of NPY receptors have yielded conflicting results, possibly due to developmental compensation. For example, mice lacking various NPY receptor genes (Y1, Y2, Y5) paradoxically showed late-onset increases in body weight rather than the expected decrease .

  • Temporal control: Inducible systems may help distinguish developmental from acute functions and avoid compensatory adaptations.

  • Spatial specificity: Cell type-specific or brain region-specific targeting using Cre-lox systems (as demonstrated with Y1R-Cre models) enables more precise functional analysis .

  • Functional readouts: Consider multiple physiological endpoints (feeding, cardiovascular, neuronal activity) to comprehensively assess phenotypic changes.

  • Species selection: Given the guinea pig's evolutionary position and receptor similarities to humans, developing guinea pig gene modification models could provide unique translational insights .

  • Combined approaches: Integrating genetic modification with pharmacological interventions may provide complementary perspectives on NPY1R function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.