Recombinant Guinea pig Platelet-activating factor receptor (PTAFR)

Shipped with Ice Packs
In Stock

Description

Production Systems and Purification

Recombinant Guinea Pig PTAFR is produced in two primary systems:

SystemSourceAdvantagesLimitations
ProkaryoticE. coliHigh yield (~85% purity), cost-effective No post-translational modifications .
EukaryoticYeastPotential for glycosylation/folding Lower yield, complex purification .

Purification Protocol

  • Affinity Chromatography: Ni-NTA columns for His-tagged variants .

  • Purity: >85% confirmed via SDS-PAGE .

  • Reconstitution: Lyophilized protein reconstituted in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Biological Activity and Functional Assays

Recombinant PTAFR demonstrates high-affinity ligand binding and downstream signaling:

Binding Kinetics

  • PAF Affinity: Kd=2.6nMK_d = 2.6 \, \text{nM} in lung tissue homogenates .

  • Antagonist Binding: WEB 2086 inhibits PAF binding with pseudo-Hill slopes near unity .

Signaling Pathways

  • G Protein Coupling: Activates GqG_q-PLC-IP3 and GiG_i-adenylate cyclase pathways .

  • Cellular Responses:

    • Calcium mobilization in eosinophils .

    • NF-κB activation and cyclooxygenase-2 induction .

4.1. Inflammation and Immune Modulation

  • Asthma: PTAFR activation in guinea pig eosinophils stimulates thromboxane A2A_2 (TXB2\text{TXB}_2) and prostaglandin E1/E2\text{E}_1/\text{E}_2 synthesis, exacerbating bronchial hyperreactivity .

  • Sepsis: PTAFR antagonists (e.g., rupatadine) reduce systemic inflammation in preclinical models .

4.2. Urological Studies

  • Bladder Contractility: PTAFR mRNA is expressed in guinea pig urinary bladder tissues, enhancing smooth muscle contraction via Ca2+\text{Ca}^{2+}-dependent mechanisms .

4.3. Drug Development

  • Antagonist Screening: Recombinant PTAFR facilitates high-throughput testing of inhibitors like WEB 2086 and RP52770 .

Key Research Findings

StudyModelKey ResultReference
1Kidney CortexHighest PTAFR mRNA and protein density (~522 fmol/mg) .
2Lung TissueBmax=200fmol/mgB_{\text{max}} = 200 \, \text{fmol/mg}, single binding class .
3EosinophilsPAF-induced TXB2\text{TXB}_2 release (EC50_{50} = 20–40 nM) .
4Urinary BladderPtafr\text{Ptafr} mRNA confirmed via RT-qPCR .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its inclusion.
Synonyms
PTAFR; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Uniprot No.

Target Background

Function
The Platelet-activating factor receptor (PTAFR) is a receptor for platelet-activating factor, a chemotactic phospholipid mediator with potent inflammatory, smooth-muscle contractile, and hypotensive properties. This receptor is believed to mediate its actions through a G protein that activates a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of guinea pig PTAFR and how does it compare to human PTAFR?

Guinea pig PTAFR belongs to the rhodopsin-like G protein-coupled receptor (GPCR) family, featuring seven transmembrane domains. Comparative analysis with human PTAFR reveals approximately 60% sequence identity, with highest conservation (80-90%) in transmembrane domains 2, 3, and 7 . The receptor contains conserved amino acid motifs characteristic of Class A GPCRs, including an asparagine in TMD1, aspartate residues in TMD2 and TMD7, a LXXXD motif in TMD2, and a tryptophan in TMD4 .

Notable differences include the guinea pig PTAFR containing an NRF sequence instead of the DRY motif found in other GPCRs' second intracellular loop, which is involved in G-protein coupling. The guinea pig receptor maintains two conserved N-linked glycosylation sites and multiple serine/threonine residues that serve as potential phosphorylation sites for protein kinases A, G, and C .

What are the binding characteristics of guinea pig PTAFR with its ligands?

Radioligand binding studies in guinea pig peripheral lung tissue demonstrate that PTAFR binds PAF with high affinity. Specifically, [³H]C16-PAF binding exhibits a dissociation constant (Kd) of 2.6 nM from saturation isotherms and 0.9 nM from kinetic experiments, with a mean receptor density of approximately 200 fmol/mg protein . The binding can be inhibited competitively by unlabeled C16-PAF, PTAFR antagonists WEB 2086, and RP52770, all demonstrating pseudo-Hill slopes of unity in antagonist inhibition studies .

Interestingly, agonist inhibition profiles show shallow slopes, suggesting PTAFR exists in multiple affinity states or conformational forms in guinea pig tissues. This pharmacological heterogeneity may be functionally significant and should be considered when designing receptor inhibition experiments .

How is PTAFR gene expression regulated in different guinea pig tissues?

PTAFR shows tissue-specific expression patterns in guinea pigs. Quantitative RT-PCR analysis reveals that PTAFR is abundantly expressed in multiple tissues, with notably higher expression (approximately twofold) in bone marrow compared to liver and lungs . In immune cells, PTAFR is consistently expressed in monocytes/macrophages, including cell lines (HD11), bone marrow-derived macrophages (BMDM), and peripheral blood mononuclear cells (PBMC) .

Expression dynamics during cell differentiation reveal that bone marrow mononuclear cells rapidly downregulate PTAFR expression (approximately threefold) following colony-stimulating factor 1 (CSF-1) treatment, though expression returns to normal levels as cells differentiate into macrophages . This temporal regulation suggests developmental control of PTAFR expression during immune cell maturation.

What are the optimal conditions for expressing recombinant guinea pig PTAFR in heterologous systems?

For optimal recombinant guinea pig PTAFR expression, mammalian expression systems using HEK293 or CHO cells are recommended over bacterial systems due to the requirement for post-translational modifications. The expression vector should contain a strong promoter (e.g., CMV) and incorporate a signal peptide to ensure proper membrane targeting. Transfection efficiency can be optimized using lipid-based transfection reagents with a DNA:reagent ratio of 1:3.

Expression should be verified through multiple complementary approaches:

  • Western blotting using validated anti-PTAFR antibodies (40 kDa predicted band size)

  • Immunofluorescence microscopy to confirm membrane localization

  • Functional calcium mobilization assays to verify receptor activity

Stable cell lines expressing guinea pig PTAFR can be established using antibiotic selection (G418 or puromycin) following transfection, with expression levels confirmed via radioligand binding assays. Single-cell cloning of transfected populations is recommended to isolate high-expressing clones for consistent experimental results .

What are validated methods for measuring guinea pig PTAFR activation in cellular assays?

Several validated methodologies can assess guinea pig PTAFR activation:

  • Calcium Mobilization Assays: Load cells with calcium-sensitive fluorescent indicators (Fluo-4 AM or Fura-2) and measure fluorescence intensity changes upon PAF stimulation. PAF concentrations between 10⁻⁹ and 10⁻⁶ M typically yield robust responses. Specificity should be confirmed using PTAFR antagonists such as WEB 2086 or PCA 4248 .

  • Inositol Phosphate Accumulation: Measure IP₃ production using radioactive precursors ([³H]myo-inositol) followed by anion exchange chromatography, or using ELISA-based IP₃ detection kits.

  • cAMP Inhibition Assays: Measure the inhibition of forskolin-stimulated cAMP production using ELISA or homogeneous time-resolved fluorescence (HTRF) technology.

  • Receptor Internalization: Track receptor trafficking using GFP-tagged PTAFR or immunofluorescent staining with specific antibodies following stimulation with PAF.

  • Functional Cellular Assays: Measure PAF-induced reactive oxygen species (ROS) production using fluorescent probes, or assess phagocytosis enhancement using fluorescently labeled particles. Both processes are significantly enhanced by PAF (10 μM) and inhibited by PTAFR antagonists .

How can radioligand binding assays be optimized for recombinant guinea pig PTAFR?

For optimal radioligand binding assays with recombinant guinea pig PTAFR:

  • Membrane Preparation: Harvest cells expressing recombinant PTAFR and prepare membranes in ice-cold buffer (typically 50 mM Tris-HCl, pH 7.4, containing protease inhibitors). Homogenize and centrifuge at 40,000×g for 30 minutes at 4°C.

  • Saturation Binding: Use [³H]C16-PAF at concentrations ranging from 0.1-20 nM, incubating with 50-100 μg membrane protein for 60 minutes at 25°C. Define non-specific binding using excess (10 μM) unlabeled PAF or selective antagonists like WEB 2086.

  • Competition Binding: Maintain [³H]C16-PAF at its Kd value (approximately 1-2 nM) while varying competitor concentrations (10⁻¹¹ to 10⁻⁵ M).

  • Binding Buffer Optimization: Use 50 mM Tris-HCl, pH 7.4, containing 5 mM MgCl₂, 1 mM CaCl₂, and 0.1% BSA to prevent non-specific binding to tubes.

  • Separation Method: Terminate reactions by rapid filtration through glass fiber filters pre-soaked in 0.3% polyethylenimine. Wash filters three times with ice-cold buffer and measure radioactivity by liquid scintillation counting.

This methodology has demonstrated reliable results in guinea pig lung tissue, with [³H]C16-PAF binding showing high affinity (Kd of 2.6 nM) and a receptor density of approximately 200 fmol/mg protein .

What are the primary downstream signaling pathways activated by guinea pig PTAFR?

Guinea pig PTAFR activates multiple signaling pathways through its coupling to Gq and Gi proteins. The primary signaling mechanisms include:

  • Phospholipase C Activation: PTAFR couples to Gq proteins, activating phospholipase C (PLC), which hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP₂) to generate inositol triphosphate (IP₃) and diacylglycerol (DAG). IP₃ triggers calcium release from intracellular stores, while DAG activates protein kinase C (PKC) .

  • Calcium Mobilization: PAF stimulation (10⁻⁹ to 10⁻⁶ M) induces rapid and transient increases in intracellular calcium concentration, which can be measured using fluorescent calcium indicators. This response is specifically blocked by PTAFR antagonists like PCA 4248 and WEB 2086 .

  • Adenylate Cyclase Inhibition: Through Gi protein coupling, PTAFR activation inhibits adenylate cyclase, reducing intracellular cAMP levels .

  • MAP Kinase Activation: Downstream of these initial pathways, PTAFR activation stimulates mitogen-activated protein kinases (MAPKs), including ERK1/2, promoting cellular responses like proliferation and gene expression.

  • NF-κB Activation: PAF stimulation leads to nuclear factor-κB (NF-κB) activation and subsequent pro-inflammatory gene induction, including cyclooxygenase-2 (COX-2) .

These pathways collectively contribute to the pro-inflammatory effects of PAF, including enhanced phagocytosis and ROS production by macrophages .

How can functional guinea pig PTAFR responses be measured in primary immune cells?

For measuring functional PTAFR responses in primary guinea pig immune cells:

  • Cell Isolation: Isolate peripheral blood mononuclear cells (PBMCs) using density gradient centrifugation or prepare bone marrow-derived macrophages (BMDMs) by culturing bone marrow cells with colony-stimulating factor 1 (CSF-1) .

  • Calcium Flux Assays: Load cells with calcium-sensitive fluorescent indicators and measure real-time calcium responses to PAF stimulation (10⁻⁹ to 10⁻⁶ M) using fluorescence plate readers or flow cytometry .

  • Phagocytosis Assays: Incubate macrophages with fluorescent zymosan beads in the presence or absence of PAF (10 μM) for 1 hour. Quantify internalized particles by fluorescence microscopy or flow cytometry. PAF treatment significantly enhances phagocytosis, which can be blocked by PTAFR antagonists like PCA 4248 .

  • ROS Production: Measure reactive oxygen species generation using fluorescent probes like DCF-DA following PAF stimulation (10 μM, 2 hours). This response is PTAFR-dependent and can be inhibited by PTAFR antagonists .

  • Nitric Oxide Production: Measure nitrite accumulation in cell culture supernatants using the Griess reaction to assess iNOS activity. PAF contributes to lipopolysaccharide (LPS)-induced NO production, as demonstrated by reduced NO production when PAFR is blocked .

  • Cytokine Expression: Measure pro-inflammatory cytokine gene expression using qRT-PCR or protein secretion using ELISA following PAF stimulation or in conditions where endogenous PAF production is blocked .

What is the role of PTAFR in guinea pig airway epithelial function?

PTAFR plays a significant role in guinea pig airway epithelial function, particularly in mucus secretion and inflammatory responses:

  • Mucin Secretion: PAF stimulates the release of high-molecular-weight mucin-like glycoproteins (MLG) from differentiated guinea pig tracheal epithelial cells. This effect is maximal at PAF concentrations of 10⁻⁸ to 10⁻⁹ M, while the inactive form (lyso-PAF) has no effect .

  • Arachidonic Acid Metabolism: PAF stimulation of airway epithelial cells increases production of hydroxyeicosatetraenoic acids (HETEs), specifically 15-, 12-, and 5-HETEs. This effect is not inhibited by the cyclooxygenase inhibitor indomethacin but is attenuated by nordihydroguiaretic acid (NDGA), a mixed cyclooxygenase and lipoxygenase inhibitor .

  • Receptor-Mediated Effects: The stimulatory effects of PAF on both mucin secretion and HETE formation are inhibited by specific PTAFR antagonists, CV-3988 and Ro 19 3704, with Ro 19 3704 demonstrating approximately 10-fold higher potency .

  • Airway Hyperresponsiveness: PTAFR activation contributes to airway hyperresponsiveness in guinea pig models of asthma, with PAF acting as a potent contractile agonist in guinea pig peripheral lung strips .

This receptor-mediated control of mucin secretion and inflammatory mediator production suggests PTAFR as a potential therapeutic target in respiratory diseases characterized by excessive mucus production and inflammation.

How can recombinant guinea pig PTAFR be used to screen novel PTAFR antagonists?

Recombinant guinea pig PTAFR provides an excellent platform for screening novel PTAFR antagonists through a multi-tiered approach:

  • Primary Binding Screens: Establish a competition binding assay using [³H]C16-PAF and membrane preparations from cells expressing recombinant guinea pig PTAFR. Novel compounds can be screened at a single concentration (10 μM) to identify hits with >50% inhibition of specific binding.

  • Secondary Functional Screens:
    a. Calcium mobilization assays to identify compounds that block PAF-induced intracellular calcium increases
    b. IP₃ accumulation assays to confirm inhibition of PLC-mediated signaling
    c. Receptor internalization assays to identify biased antagonists that selectively block certain pathways

  • Potency Determination: Generate full concentration-response curves (10⁻¹¹ to 10⁻⁵ M) for promising compounds to calculate IC₅₀ values in binding and functional assays.

  • Selectivity Profiling: Test compounds against related GPCRs to ensure selectivity for PTAFR.

  • Structure-Activity Relationship Analysis: Create a table correlating chemical structures with binding affinities and functional potencies to guide medicinal chemistry optimization.

Compound ClassBinding IC₅₀ (nM)Ca²⁺ Flux IC₅₀ (nM)Selectivity Ratio*Reference
WEB 20865-2010-50>100
CV-398850-100100-200>50
Ro 19 37045-1010-30>100
PCA 424820-5050-100>75

*Selectivity ratio = IC₅₀ at related receptors / IC₅₀ at PTAFR

For in vivo validation, promising compounds should be tested in guinea pig models of inflammation where PTAFR is implicated, such as airway hyperresponsiveness models or inflammatory cell recruitment assays .

What are the challenges in distinguishing between different affinity states of guinea pig PTAFR?

Distinguishing between different affinity states of guinea pig PTAFR presents several methodological challenges:

  • Agonist vs. Antagonist Binding Profiles: Radioligand binding studies with guinea pig lung tissue have revealed that while antagonist inhibition curves show pseudo-Hill slopes near unity, agonist inhibition curves are notably shallow, suggesting the existence of multiple receptor affinity states or conformations . This phenomenon complicates pharmacological characterization.

  • G-Protein Coupling Dependencies: The affinity state transitions may be dependent on G-protein coupling. Researchers should perform binding studies in the presence and absence of guanine nucleotides (GTP, GTPγS) to shift receptors toward low-affinity states and normalize binding curves.

  • Technical Approaches to Distinguish States:
    a. Receptor Solubilization and Reconstitution: Solubilize receptors with mild detergents and reconstitute with defined G-protein subunits to control the proportion of high/low affinity states
    b. Site-Directed Mutagenesis: Generate mutations in intracellular loops to stabilize specific conformational states
    c. Radioligand Binding at Different Temperatures: Low temperatures (4°C) may stabilize high-affinity states for enhanced detection

  • Analytical Methods: Use multisite binding models for data analysis, specifically testing one-site versus two-site models using statistical methods like F-tests to determine which model better fits the experimental data.

  • Combining Binding with Functional Readouts: Correlate binding data with functional assays measuring different signaling pathways to reveal potential biased signaling through different receptor conformations.

The existence of multiple PTAFR states has significant implications for drug development, as compounds may preferentially target specific conformational states, leading to unique pharmacological profiles or biased signaling .

How does guinea pig PTAFR-mediated signaling differ from human PTAFR in inflammation models?

Despite sharing approximately 60% sequence identity, guinea pig and human PTAFR exhibit important species-specific differences in signaling and pharmacological properties relevant to inflammation models:

When using guinea pig models to study PTAFR-targeted therapeutics, researchers should validate key findings in human cellular systems before clinical translation. Comparative pharmacology studies using both recombinant receptors can identify compounds with consistent cross-species activity profiles, increasing the likelihood of successful translation to human applications .

What are common technical challenges when working with recombinant guinea pig PTAFR and how can they be addressed?

Researchers frequently encounter several technical challenges when working with recombinant guinea pig PTAFR:

  • Low Expression Levels:

    • Problem: Insufficient receptor expression in heterologous systems

    • Solution: Optimize codon usage for mammalian expression, incorporate a strong Kozak sequence, and use expression tags (FLAG, HA) for detection and purification. Consider using inducible expression systems to minimize potential cytotoxicity from constitutive expression.

  • Receptor Misfolding:

    • Problem: Improper folding leading to intracellular retention

    • Solution: Culture transfected cells at reduced temperature (30-32°C) during expression, incorporate molecular chaperones, or use chemical chaperones like DMSO or glycerol in culture media.

  • Ligand Instability:

    • Problem: PAF is susceptible to degradation during storage and experimentation

    • Solution: Store PAF in glass vials under nitrogen at -80°C, prepare fresh dilutions for each experiment, and include PAF acetylhydrolase inhibitors in assay buffers to prevent degradation during longer incubations.

  • Background Signaling:

    • Problem: High basal activity in calcium or IP₃ assays

    • Solution: Reduce serum content during assays, use serum-free media for 4-6 hours before experiments, and include appropriate vehicle controls. Consider using cell lines with lower levels of endogenous Gq-coupled receptors.

  • Antibody Specificity:

    • Problem: Poor specificity of commercially available anti-PTAFR antibodies

    • Solution: Validate antibodies using PTAFR knockout controls or siRNA-mediated knockdown. Consider using epitope tags for detection rather than relying on PTAFR-specific antibodies .

  • Assay Reproducibility:

    • Problem: Variable functional responses between experiments

    • Solution: Standardize cell density, passage number, and assay conditions. Use internal standards and positive controls in each experiment to normalize responses and reduce inter-assay variability.

How can researchers distinguish between direct PTAFR-mediated effects and secondary inflammatory cascades in guinea pig models?

Distinguishing direct PTAFR effects from secondary inflammatory cascades requires specific experimental approaches:

  • Temporal Analysis: Measure responses at early time points (seconds to minutes) to capture direct receptor-mediated effects before secondary mediator cascades become active. Direct PTAFR activation typically leads to calcium mobilization within seconds, while secondary inflammatory responses take minutes to hours to develop .

  • Selective Antagonist Approach: Use multiple structurally distinct PTAFR antagonists (WEB 2086, CV-3988, PCA 4248) at carefully titrated concentrations that block PTAFR but not other receptors. If all antagonists similarly inhibit a response, it likely represents a direct PTAFR effect .

  • Signaling Pathway Inhibitors: Employ specific inhibitors of downstream pathways:

    • PI-PLC inhibitors (U73122) to block proximal PTAFR signaling

    • Intracellular calcium chelators (BAPTA-AM) to prevent calcium-dependent responses

    • PKC inhibitors (GF109203X) to block DAG-dependent pathways

  • PAF-AH Treatment: Use recombinant PAF acetylhydrolase to degrade extracellular PAF. This approach specifically reduces PTAFR-dependent effects while leaving other inflammatory pathways intact .

  • Combinatorial Inhibition Approach: Create response profiles using PTAFR antagonists in combination with inhibitors of secondary mediator production (cyclooxygenase, lipoxygenase inhibitors). In guinea pig tracheal epithelial cells, for example, PAF-induced mucin secretion is sensitive to lipoxygenase inhibitors but not cyclooxygenase inhibitors, suggesting involvement of lipoxygenase products as secondary mediators .

  • Cell-Specific PTAFR Modulation: When possible, use cells with genetic modification of PTAFR expression (overexpression, knockout, or knockdown) to confirm direct receptor involvement in observed responses.

What are the critical parameters for validating recombinant guinea pig PTAFR expression and function?

Comprehensive validation of recombinant guinea pig PTAFR requires assessment of multiple parameters:

  • Expression Verification:

    • Protein Level: Western blot analysis using validated antibodies (expected band at 40 kDa) or detection of epitope tags if incorporated

    • mRNA Level: qRT-PCR using guinea pig PTAFR-specific primers with appropriate housekeeping gene normalization

    • Subcellular Localization: Immunofluorescence microscopy to confirm plasma membrane localization, which is essential for proper function

  • Binding Characteristics:

    • Saturation Binding: Determine Bmax (receptor density) and Kd (affinity) using [³H]C16-PAF; expected Kd ≈ 1-3 nM for properly folded receptor

    • Competition Binding: Verify displacement by known PTAFR ligands and antagonists with expected rank order potency (PAF > WEB 2086 > CV-3988)

    • Binding Kinetics: Measure association and dissociation rates to calculate kinetic Kd values, which should match equilibrium values

  • Functional Responses:

    • Calcium Mobilization: Confirm PAF-induced calcium responses (EC₅₀ ≈ 1-10 nM) that are inhibited by PTAFR antagonists

    • IP₃ Production: Verify PAF-stimulated IP₃ generation as evidence of PLC activation

    • cAMP Inhibition: Measure inhibition of forskolin-stimulated cAMP production to confirm Gi coupling

  • Pharmacological Profile:

    • Agonist Selectivity: Demonstrate activity of PAF but not lyso-PAF

    • Antagonist Sensitivity: Confirm inhibition by selective antagonists with expected potency rank order

    • Species Pharmacology Comparison: Compare pharmacological profiles with human PTAFR to identify species differences

  • Downstream Signaling:

    • MAP Kinase Activation: Verify PAF-induced ERK1/2 phosphorylation

    • Transcriptional Responses: Measure PAF-induced changes in inflammatory gene expression

    • Functional Cellular Responses: Confirm enhanced phagocytosis and ROS production in response to PAF stimulation

A complete validation should include both positive controls (known PTAFR activators) and negative controls (cells transfected with empty vector) to ensure specificity of the observed responses.

What are promising new approaches for studying PTAFR-mediated neuroinflammation using guinea pig models?

Recent developments suggest several innovative approaches for investigating PTAFR-mediated neuroinflammation in guinea pig models:

  • Advanced Imaging Techniques:

    • In vivo PET Imaging: Develop [¹¹C] or [¹⁸F]-labeled PTAFR ligands for positron emission tomography to visualize receptor distribution and occupancy in the guinea pig brain under normal and inflammatory conditions

    • Two-photon Microscopy: Utilize fluorescently-tagged PAF analogs combined with fluorescent reporter proteins to visualize real-time PTAFR activation in microglia within intact brain slices

  • Single-Cell Transcriptomics:

    • Apply single-cell RNA sequencing to identify cell type-specific PTAFR expression patterns in the guinea pig brain and track transcriptional responses to inflammatory stimuli

    • Characterize PTAFR-dependent gene expression networks in microglia, astrocytes, and neurons during neuroinflammatory processes

  • CRISPR-Based Approaches:

    • Develop CRISPR/Cas9 systems optimized for guinea pig cells to create precise modifications in the PTAFR gene

    • Generate guinea pig cell lines or primary cultures with reporter tags inserted at the endogenous PTAFR locus to monitor native receptor trafficking and signaling

  • Chemogenetic Regulation:

    • Engineer chimeric guinea pig PTAFR receptors containing designer receptors exclusively activated by designer drugs (DREADD) components to allow temporal control of receptor activation in specific cell populations

    • Use this approach to dissect the contribution of PTAFR signaling in different brain cell types to neuroinflammatory outcomes

  • Translational Electrophysiology:

    • Combine PTAFR pharmacological manipulation with electrophysiological recordings in guinea pig hippocampal slice preparations to investigate PTAFR's role in modulating synaptic plasticity during inflammation

    • Correlate electrophysiological changes with behavioral assessments in models of neuroinflammatory disorders

  • Exosome-Based Delivery Systems:

    • Develop exosome-based delivery of PTAFR modulators (antagonists, siRNA) to specific brain regions or cell types

    • Utilize this approach to achieve targeted intervention in neuroinflammatory cascades while minimizing systemic effects

These approaches would significantly advance our understanding of PTAFR's role in neuroinflammatory conditions and potentially identify novel therapeutic strategies.

How can recombinant guinea pig PTAFR studies inform the development of biased ligands for therapeutic applications?

Recombinant guinea pig PTAFR provides an excellent platform for developing biased PTAFR ligands with improved therapeutic profiles:

  • Pathway-Specific Signaling Analysis:

    • Systematically compare PAF-induced signaling across multiple pathways (calcium mobilization, ERK activation, β-arrestin recruitment) in cells expressing recombinant guinea pig PTAFR

    • Develop a signaling fingerprint matrix for known ligands to identify pathway bias patterns associated with beneficial versus detrimental effects

  • Structure-Based Drug Design:

    • Generate homology models of guinea pig PTAFR based on recent GPCR crystal structures

    • Perform molecular docking studies with virtual compound libraries to identify structures predicted to selectively engage specific signaling conformations

    • Validate computational predictions with targeted medicinal chemistry and functional assays

  • Mutational Analysis for Biased Signaling:

    • Create point mutations in guinea pig PTAFR intracellular loops and transmembrane domains predicted to selectively alter coupling to specific signaling pathways

    • Use these mutants to identify key receptor-ligand interactions that determine signaling bias

  • Comparative Pharmacology:

    • Systematically compare pharmacological profiles between guinea pig and human PTAFR to identify species-conserved signaling biases that may translate to clinical applications

    • Focus on compounds that maintain beneficial anti-inflammatory effects while minimizing pro-inflammatory signaling

  • Therapeutic Context Screening:

    • Evaluate candidate biased ligands in disease-relevant functional assays:

      • Airway epithelial cell mucin production for respiratory applications

      • Macrophage ROS production and phagocytosis for inflammatory disease applications

      • Platelet aggregation for cardiovascular applications

  • Allosteric Modulator Development:

    • Screen for compounds that bind to sites distinct from the orthosteric PAF binding pocket

    • Characterize how these allosteric modulators selectively enhance or inhibit specific signaling pathways

    • Develop positive allosteric modulators that enhance beneficial PTAFR signaling while minimizing detrimental pathways

This systematic approach could lead to the development of next-generation PTAFR modulators with improved therapeutic indices for conditions like asthma, allergic rhinitis, and inflammatory disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.