Recombinant Guinea pig Potassium channel subfamily K member 9 (KCNK9)

Shipped with Ice Packs
In Stock

Description

Research Findings in Guinea Pig Models

While recombinant Guinea Pig KCNK9 is not explicitly documented, antibody-based studies and cross-reactivity data highlight its relevance in Guinea Pig physiology:

Colonic Motor Function

KCNK9 is implicated in colonic motility. In rat studies (extrapolated to Guinea Pig), KCNK9 blockade with hydroxy-α sanshool induced periodic motor patterns, suggesting its role in enteric neuronal excitability .

StudyFindings
Colonic Motor ActivityKCNK9 inhibition alters motor patterns; linked to pH-sensitive signaling
LocalizationExpressed in myenteric plexus and circular muscle layer neurons
Functional PartnersCo-localizes with PGP9.5 (neuronal marker) and c-Kit (interstitial cells)

Antibody Cross-Reactivity and Tools

Antibodies targeting KCNK9 demonstrate partial cross-reactivity with Guinea Pig tissues, enabling indirect studies:

AntibodyReactivityApplicationSource
ABIN6142756Human, Mouse, Guinea PigWestern BlottingAntibodies Online
PA5-41044Human, Guinea PigWestern Blotting, IHCThermo Fisher
ABIN2776216Guinea Pig, Rat, HumanIHC, ELISAAntibodies Online

Key Features of Antibodies

  • Epitope Targeting: AA 265–374 (human KCNK9) .

  • Validation: Confirmed via Western Blotting and immunohistochemistry .

Challenges and Future Directions

  • Recombinant Protein Availability: No Guinea Pig-specific KCNK9 is commercially available. Mouse or human recombinant proteins (e.g., Creative Biomart’s His-tagged mouse KCNK9 ) are used as surrogates.

  • Species-Specific Studies: Guinea Pig models are underutilized compared to mice or rats, limiting direct mechanistic insights.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNK9; TASK3; Potassium channel subfamily K member 9; Acid-sensitive potassium channel protein TASK-3; TWIK-related acid-sensitive K(+ channel 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
KCNK9
Target Protein Sequence
MKKQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIRGKYNISTEDYR QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQ CEEWSFFHAYYYCFITLTTIGFGDYVALQSKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSDEERGEGEEGAALPGNPSSVVTHISEEARQVRQRYRGEGGDLQSVCSCA CYRSQPQNFGATLAPQPLHSISCRIEEISPSTLKNSLFPSPISSVSPGLHSFGDNHRLML RRKSV
Uniprot No.

Target Background

Function
pH-dependent, voltage-insensitive, background potassium channel protein.
Gene References Into Functions
  1. An extracellular ion pathway plays a central role in the cooperative gating of a K(2P) K+ channel by extracellular pH. PMID: 23319597
Database Links
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the brain.

Q&A

What is KCNK9 and what is its functional significance?

KCNK9 provides instructions for making a protein called TASK3, which functions as a potassium channel. These channels transport positively charged potassium ions into and out of cells. TASK3 channels are especially abundant in neurons in the brain, particularly in the cerebellum, which coordinates movement . The potassium channel plays critical roles in establishing membrane potential and regulating cellular excitability in various tissues. The functional significance of KCNK9 extends to multiple physiological processes including respiration, cardiac function, and neuronal activity regulation .

How does guinea pig KCNK9 compare structurally to human KCNK9?

Guinea pig KCNK9 shares significant sequence homology with human KCNK9, approximately 93% based on peptide sequence analysis . This high conservation suggests functional similarity across species. The conserved regions typically include the pore domains and transmembrane segments that are critical for channel function. The key structural elements that define the selectivity filter and gating mechanisms appear to be maintained between species, making guinea pig models valuable for translational research .

What research models utilize guinea pig KCNK9 and why?

Guinea pig models are particularly valuable for KCNK9 research due to their physiological similarities to humans in certain systems. They are used in:

  • Cardiac research: Guinea pigs serve as non-diving mammal controls in comparative studies with diving mammals like muskrats to examine hypoxia responses and potassium channel function in cardiac tissue

  • Allergic respiratory research: Guinea pigs have been developed as models for concurrent allergic rhinitis and asthma, where potassium channel function may play a modulatory role

  • Neuroscience: Their brain physiology makes them suitable for studying the role of KCNK9 in neuronal functions

The recombinant guinea pig KCNK9 protein allows for isolated study of channel properties in controlled experimental systems .

How do post-translational modifications affect guinea pig KCNK9 channel function?

Post-translational modifications significantly alter guinea pig KCNK9 channel gating and conductance properties. Phosphorylation of specific serine and threonine residues by protein kinases like PKA and PKC can modulate channel open probability. Specifically, phosphorylation events may affect pH sensitivity and responses to hypoxic conditions, which is particularly relevant in cardiac and neuronal tissues .

Additionally, S-nitrosylation and redox modifications of cysteine residues can dynamically alter channel function in response to cellular metabolic state. These modifications represent important regulatory mechanisms that allow for context-dependent channel function adaptation .

What is known about KCNK9 genomic imprinting in guinea pigs compared to humans?

While extensive research has characterized KCNK9 imprinting in humans, where paternal imprinting has been documented, the imprinting status in guinea pigs remains less thoroughly explored. In humans, KCNK9 imprinting syndrome is a rare condition characterized by hypotonia from birth, intellectual disability, and distinctive facial features .

Studies using quantitative PCR techniques with threshold cycle (Ct) values and inverse-normal quantile transformation have been employed to detect parent-of-origin effects in KCNK9 expression . Research suggests that imprinting mechanisms may be conserved across mammalian species, but species-specific variations in imprinting control regions and methylation patterns exist. Further comparative research is needed to fully characterize the imprinting patterns of KCNK9 in guinea pigs .

How does the electrophysiological profile of recombinant guinea pig KCNK9 differ from native channels?

Recombinant guinea pig KCNK9 channels may exhibit subtle differences from native channels due to:

  • Altered post-translational modification patterns in expression systems

  • Absence of native regulatory proteins or subunits

  • Different membrane composition in expression systems versus native cells

Electrophysiological studies have shown that while core properties like potassium selectivity and basic gating characteristics are preserved, kinetics and sensitivity to modulators may differ. Native channels in guinea pig tissues typically demonstrate more complex regulation with greater sensitivity to physiological stimuli like hypoxia .

For example, in cardiac hypoxia studies, guinea pig hearts show distinctive responses to ATP-sensitive potassium channel modulation that may involve KCNK9, suggesting unique regulatory mechanisms in native tissues that may not be fully recapitulated in recombinant systems .

What are the optimal expression systems for recombinant guinea pig KCNK9 production?

The choice of expression system significantly impacts the quality and functionality of recombinant guinea pig KCNK9. The table below compares common expression systems for KCNK9 research:

Expression SystemAdvantagesLimitationsRecommended Applications
HEK293 cellsHigh expression levels, mammalian post-translational modificationsMay not replicate tissue-specific modificationsElectrophysiology, drug screening
CHO cellsStable expression, good for large-scale productionLower expression than HEK293Biochemical studies, antibody production
Xenopus oocytesExcellent for electrophysiology, low background K+ channelsNon-mammalian modificationsDetailed electrophysiological characterization
Sf9 insect cellsHigh yield for structural studiesNon-mammalian glycosylation patternsProtein purification for structural analysis

For immunological studies, recombinant protein expression should include the target epitopes (such as AA 250-362) to ensure antibody recognition . The expression system should be selected based on the specific research goals, with consideration for proper folding and post-translational modifications critical for channel function.

What purification strategies yield the highest quality recombinant guinea pig KCNK9?

Purification of functional recombinant guinea pig KCNK9 requires strategies that maintain protein integrity and native conformation. A multi-step purification approach is recommended:

  • Initial Extraction: Use mild detergents (DDM, LMNG, or digitonin) that preserve membrane protein structure

  • Affinity Chromatography: Employ His-tag or Flag-tag systems for initial capture

  • Size Exclusion Chromatography: Remove aggregates and ensure homogeneity

  • Quality Control: Verify purity through SDS-PAGE and functional activity through reconstitution assays

Research indicates that protein G purification has been successfully used for KCNK9-related antibodies, achieving >95% purity . For the recombinant protein itself, maintaining the native lipid environment or reconstituting into nanodiscs or liposomes may be necessary to preserve channel functionality for downstream applications.

How can researchers validate the functionality of purified recombinant guinea pig KCNK9?

Functional validation of recombinant guinea pig KCNK9 requires multiple complementary approaches:

  • Electrophysiological Assays:

    • Patch-clamp recording to verify channel conductance and selectivity

    • Two-electrode voltage clamp in Xenopus oocytes to assess macroscopic current characteristics

  • Biochemical Validation:

    • Western blotting with specific antibodies (such as those recognizing AA 250-362) to confirm protein integrity

    • Limited proteolysis to assess proper folding

  • Ligand Binding Assays:

    • Fluorescence-based binding assays with known KCNK9 modulators

    • Competition binding studies to verify pharmacological profile

  • Modulator Response Testing:

    • Channel activation with KCNK9 openers like Lemakalim

    • Channel inhibition with blockers such as glibenclamide

Functional assays should include assessment of key channel properties like pH sensitivity, temperature response, and modulation by pharmacological agents to confirm that the recombinant protein retains native-like characteristics .

How should researchers design experiments to study KCNK9 regulation during hypoxia in guinea pig models?

Designing robust experiments to study KCNK9 regulation during hypoxia requires careful consideration of multiple factors:

  • Model Selection:

    • Isolated perfused heart preparations provide controlled environments for studying cardiac responses

    • Primary neuronal cultures can examine cell-specific responses

    • Acute tissue slices maintain native architecture and connections

  • Hypoxia Protocol Design:

    • Define precise oxygen levels (typically 1-5% O₂) and duration

    • Implement controlled reoxygenation phases

    • Monitor temperature, pH, and metabolite levels

  • Key Measurements:

    • Real-time potassium flux using potassium-sensitive electrodes

    • Membrane potential recordings in single cells or tissues

    • KCNK9 protein expression and phosphorylation state analysis

    • Functional readouts like heart rate, contractility, or neuronal activity

  • Pharmacological Interventions:

    • Channel activators (Lemakalim) and inhibitors (glibenclamide) should be applied at physiologically relevant concentrations

    • Include controls for vehicle effects and time-dependent changes

Research has shown that muskrat and guinea pig hearts respond differently to hypoxia, with guinea pigs showing greater sensitivity to ATP-sensitive potassium channel modulation . This suggests species-specific regulation that should be considered when designing comparative studies. Channel inhibition experiments should be carefully monitored as some inhibitors like glibenclamide have shown damaging effects in certain species during hypoxia .

What techniques are most effective for studying KCNK9 protein-protein interactions in guinea pig tissues?

Several complementary techniques provide insights into KCNK9 protein-protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use specific antibodies like polyclonal antibodies targeting AA 250-362

    • Apply crosslinking strategies for transient interactions

    • Validate with reverse Co-IP and appropriate controls

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusion proteins expressed in guinea pig cells

    • TurboID for rapid labeling of proximal proteins

    • MS analysis of biotinylated proteins to identify interactors

  • FRET/BRET Analysis:

    • Create fluorescent protein fusions of KCNK9 and potential partners

    • Measure energy transfer as indication of proximity

    • Live-cell imaging to monitor dynamic interactions

  • Molecular Dynamics Simulations:

    • Computational modeling based on known structures

    • Prediction of interaction interfaces for experimental validation

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Chemical cross-linking of protein complexes

    • MS identification of cross-linked peptides

    • Determination of spatial relationships between proteins

When designing these experiments, consider that KCNK9 interactions may be tissue-specific and context-dependent. For instance, interactions in cardiac tissue during hypoxia may differ from those in neuronal tissue . The choice of detergents during extraction is critical to maintain physiologically relevant interactions.

How can researchers effectively compare Guinea pig KCNK9 function across different experimental models?

To effectively compare guinea pig KCNK9 function across different experimental models, researchers should implement a standardized framework:

  • Standardized Expression Systems:

    • Use identical promoters and expression vectors across systems

    • Quantify expression levels and normalize functional data accordingly

    • Apply consistent post-translational modification analysis

  • Controlled Recording Conditions:

    • Standardize temperature, pH, and ionic compositions

    • Use identical recording protocols and equipment where possible

    • Include internal standards and calibration controls

  • Cross-Validation Strategy:

    • Apply multiple techniques to measure the same parameter

    • Correlate electrophysiological data with biochemical measurements

    • Use mathematical modeling to reconcile differences between systems

  • Systematic Pharmacological Profiling:

    • Test response to a panel of channel modulators

    • Generate complete dose-response curves

    • Calculate standardized parameters (EC50, IC50) for comparison

Research has demonstrated that even within a species, tissue-specific differences in KCNK9 function exist. For example, cardiac and neuronal KCNK9 channels may show distinct regulatory mechanisms and pharmacological responses . These differences should be systematically documented and correlated with tissue-specific expression of regulatory proteins.

How should researchers interpret contradicting functional data between recombinant and native guinea pig KCNK9 channels?

When faced with contradicting functional data between recombinant and native guinea pig KCNK9 channels, researchers should employ a systematic analytical approach:

  • Source Analysis:

    • Examine differences in experimental conditions (temperature, pH, ionic strength)

    • Assess expression system effects on post-translational modifications

    • Consider membrane environment differences (lipid composition, cholesterol content)

  • Contextual Integration:

    • Native channels exist within macromolecular complexes that may alter function

    • Auxiliary subunits present in native tissues may be absent in recombinant systems

    • Tissue-specific regulatory mechanisms may not be replicated in expression systems

  • Resolution Strategies:

    • Reconstitute recombinant channels with putative missing components

    • Perform experiments under increasingly native-like conditions

    • Use CRISPR-modified cells to study channels in more physiological contexts

  • Data Reconciliation Framework:

    • Develop mathematical models that account for differences

    • Identify key variables that explain discrepancies

    • Design critical experiments to test hypotheses about differences

For example, research has shown that hypoxia-induced responses in guinea pig cardiac tissue involve complex interactions between KCNK9 and other potassium channels that may not be replicated in isolated systems . When glibenclamide was applied to inhibit potassium channels during hypoxia, it was only partially successful in blocking bradycardia in guinea pig hearts, suggesting multiple regulatory mechanisms operate in the native context .

What statistical approaches are most appropriate for analyzing KCNK9 electrophysiological data from guinea pig models?

Analyzing KCNK9 electrophysiological data requires sophisticated statistical approaches that address the complexity and variability inherent in these measurements:

  • Hierarchical Mixed-Effects Models:

    • Account for both within-cell and between-cell variability

    • Incorporate random effects for individual cells/animals

    • Handle repeated measures from the same preparation

  • Non-Parametric Alternatives:

    • Apply when normality assumptions are violated

    • Mann-Whitney U test for two-group comparisons

    • Kruskal-Wallis with post-hoc tests for multiple groups

  • Time Series Analysis:

    • Autoregressive integrated moving average (ARIMA) models for temporal patterns

    • Wavelet analysis for identifying frequency components

    • Change-point detection for identifying transitions in channel behavior

  • Bayesian Approaches:

    • Incorporate prior knowledge about channel properties

    • Generate posterior probability distributions for parameters

    • Allow for more robust estimates with small sample sizes

  • Machine Learning for Pattern Recognition:

    • Clustering algorithms to identify distinct channel states

    • Support vector machines for classification of response patterns

    • Principal component analysis for dimensionality reduction

Research examining KCNK9 expression has employed sophisticated statistical techniques such as inverse-normal quantile transformation of raw Ct values and linear mixed models to account for technical replicates as random effects and parental origin as fixed effects . These approaches provide rigorous frameworks for analyzing complex electrophysiological data.

How can researchers integrate multi-omics data to better understand guinea pig KCNK9 regulation in health and disease?

Integrating multi-omics data provides a comprehensive understanding of KCNK9 regulation:

  • Multi-Layer Data Collection:

    • Transcriptomics: RNA-seq for expression levels and splice variants

    • Proteomics: Mass spectrometry for protein abundance and modifications

    • Metabolomics: Assess metabolic context affecting channel function

    • Epigenomics: Analyze methylation and chromatin state at KCNK9 locus

  • Integration Methodologies:

    • Network analysis to identify regulatory hubs

    • Pathway enrichment to contextualize KCNK9 function

    • Correlation analyses across omics layers

    • Causal inference modeling to establish regulatory relationships

  • Tissue-Specific Considerations:

    • Compare regulatory networks across tissues (brain vs. heart)

    • Identify tissue-specific transcription factors and epigenetic regulators

    • Correlate with tissue-specific channel properties

  • Disease Context Analysis:

    • Compare healthy vs. pathological states

    • Identify dysregulated pathways affecting KCNK9

    • Develop signatures predictive of altered channel function

Research on KCNK9 imprinting syndrome has demonstrated the value of integrating genetic, clinical, and functional data to understand disease mechanisms . For guinea pig models, similar integration can provide insights into how KCNK9 regulation varies across physiological contexts, such as during hypoxia response in cardiac tissue or in neurological functions .

What are emerging technologies for studying KCNK9 dynamics in real-time in guinea pig models?

Cutting-edge technologies are revolutionizing real-time KCNK9 research:

  • Genetically Encoded Sensors:

    • FRET-based voltage sensors fused to KCNK9

    • Conformational reporters that signal channel state changes

    • Calcium indicators to correlate KCNK9 activity with calcium signaling

  • Advanced Imaging Techniques:

    • Super-resolution microscopy (STORM, PALM) for nanoscale localization

    • Light-sheet microscopy for whole-tissue imaging with cellular resolution

    • Multiphoton imaging for deep tissue visualization in intact organs

  • Electrophysiological Innovations:

    • High-throughput automated patch-clamp arrays

    • Wireless recording systems for freely moving animals

    • Multielectrode arrays for spatial mapping of activity

  • Optogenetic and Chemogenetic Control:

    • Light-activated KCNK9 channel variants

    • Designer receptors exclusively activated by designer drugs (DREADDs)

    • Photoswitchable ligands for precise temporal control

These technologies enable unprecedented investigations into how KCNK9 functions during complex physiological processes, such as the hypoxic response in cardiac tissue or in neuronal circuits affected in KCNK9 imprinting syndrome .

How can computational modeling advance our understanding of guinea pig KCNK9 structure-function relationships?

Computational approaches offer powerful insights into KCNK9 function:

  • Molecular Dynamics Simulations:

    • All-atom simulations of KCNK9 in lipid bilayers

    • Analysis of ion permeation and gating mechanisms

    • Prediction of drug binding sites and interactions

  • Homology Modeling:

    • Generate guinea pig-specific structural models based on human or rodent templates

    • Identify species-specific structural features

    • Predict functional consequences of sequence variations

  • Systems Biology Models:

    • Integrate KCNK9 into cell-level signaling networks

    • Model interactions with regulatory pathways

    • Predict system-level responses to channel modulation

  • Machine Learning Applications:

    • Predict functional impacts of mutations

    • Identify novel modulators through virtual screening

    • Classify channel states from experimental data

Research has demonstrated that computational and experimental methods can be integrated to solve disease mechanisms, as shown in the analysis of KCNK9 variants that cause gain or loss of channel function . Similar approaches can be applied to understand species-specific aspects of guinea pig KCNK9.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.