Recombinant Guinea pig Potassium voltage-gated channel subfamily E member 2 (Kcne2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Guinea Pig Potassium Voltage-Gated Channel Subfamily E Member 2 (Kcne2)

The recombinant guinea pig potassium voltage-gated channel subfamily E member 2 (Kcne2) protein is a recombinant form of the Kcne2 protein, which is expressed in Escherichia coli and fused with an N-terminal His tag. This protein is crucial for studying the function and regulation of potassium channels in various biological systems. Kcne2 is known to modulate the activity of voltage-gated potassium channels, influencing cardiac and other cellular functions.

Structure and Expression

  • Structure: The recombinant Kcne2 protein consists of 123 amino acids and includes a single membrane-spanning region, similar to its human counterpart. It has an extracellular N-terminal and an intracellular C-terminal domain .

  • Expression: The protein is expressed in E. coli, which provides a cost-effective and efficient method for large-scale production. The His tag facilitates purification and detection of the recombinant protein .

Function and Role

Kcne2 proteins are accessory subunits that modulate the gating kinetics and stability of voltage-gated potassium channels. In the heart, Kcne2 is associated with the hERG channel, influencing the rapidly activating component of the delayed rectifying potassium current (IKr), which is crucial for cardiac repolarization . In other tissues, Kcne2 can interact with different potassium channels, affecting cellular excitability and ion balance.

Data Tables

Given the limited specific data available for recombinant guinea pig Kcne2, we can refer to general properties of Kcne2 proteins:

PropertyDescription
Amino Acids123 amino acids
Expression SystemEscherichia coli
TagN-terminal His tag
FunctionModulates potassium channel activity
Tissue ExpressionHeart, choroid plexus, gastric epithelium

References Abbott et al. (1999) - Interaction of KCNE2 with KCNQ1 channels. STRING interaction network - KCNE2 protein interactions. Circulation: Arrhythmia and Electrophysiology - Loss-of-function KCNE2 variants. Creative Biomart - Recombinant Full Length Guinea Pig Potassium Voltage-Gated Channel Subfamily E Member 2 (Kcne2) Protein. PLOS ONE - Molecular expression and pharmacological evidence for Kv7 channels. Wikipedia - KCNE2 protein.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of your requested tag.
Synonyms
Kcne2; Potassium voltage-gated channel subfamily E member 2; MinK-related peptide 1; Minimum potassium ion channel-related peptide 1; Potassium channel subunit beta MiRP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Kcne2
Target Protein Sequence
MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
Uniprot No.

Target Background

Function
Kcne2 is an ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex consisting of pore-forming alpha subunits. It plays a role in modulating the gating kinetics and enhancing the stability of the channel complex. When assembled with KCNB1, it influences the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNH2/HERG, it is thought to form the rapidly activating component of the delayed rectifying potassium current in the heart (IKr). It may also associate with KCNQ2 and/or KCNQ3, modulating the native M-type current. Kcne2 may interact with HCN1 and HCN2, leading to increased potassium current. It interacts with KCNQ1, forming a heterooligomer complex that results in currents with seemingly instantaneous activation, rapid deactivation, and a linear current-voltage relationship. Additionally, it decreases the amplitude of the outward current.
Protein Families
Potassium channel KCNE family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is KCNE2 and what is its significance in cardiac function?

KCNE2 is a functionally versatile potassium channel β subunit that is ubiquitously expressed throughout the body. It has significant associations with coronary artery disease (CAD) and cardiac arrhythmia susceptibility in both humans and animal models. As a regulatory protein, KCNE2 modulates the function of various potassium channel α subunits, contributing to proper cardiac electrical activity. Its importance is underscored by its role in CAD, which typically kills more people globally each year than any other single cause of death . Understanding KCNE2 function contributes to identifying individuals at risk and developing improved therapeutic approaches for heart disease.

What is the expression pattern of KCNE2 in guinea pig heart tissues?

Research demonstrates that native KCNE2 protein is expressed in both atrial and ventricular myocytes of guinea pig hearts, with a distinct distribution pattern. Importantly, KCNE2 protein is consistently more abundant in ventricles than in atria, with ventricular expression approximately twice that of atrial expression. This ventricle-dominant expression pattern is also observed in rat and human heart tissues . The protein exhibits preferential cell surface localization in both guinea pig atrial and ventricular myocytes, which is critical for its function as it needs to be positioned where its partner channels are located. Additionally, KCNE2 shows a clear striation pattern in guinea pig cardiac myocytes, which has been confirmed through immunofluorescence studies .

What molecular weights are observed for native guinea pig KCNE2 protein?

When analyzed by immunoblotting, native guinea pig KCNE2 protein typically migrates as 32-kDa and 24-kDa bands, with occasionally a very faint 15-kDa band detected in both atria and ventricles. This banding pattern is similar to that observed in spontaneously hypertensive rat (SHR) ventricles. Although the core KCNE2 protein has a predicted mass of 15 kDa, the shift to higher molecular weight bands is not due to N-glycosylation, as demonstrated by PNGase F treatment experiments. Alternative explanations for the higher molecular weight bands include O-glycosylation, tight association with other native proteins that are not dissociated by SDS buffer, or potential dimerization of the 15-kDa species to form the 32-kDa species .

What expression systems are most effective for recombinant guinea pig KCNE2 production?

For recombinant guinea pig KCNE2 production, yeast expression systems have been successfully utilized, particularly for producing proteins with high purity (>90%). The choice of expression system depends on experimental requirements and downstream applications. While yeast is commonly used for guinea pig KCNE2, other expression systems employed for KCNE2 from different species include HEK-293 cells (for human and mouse KCNE2), Escherichia coli (for rat KCNE2), and cell-free protein synthesis systems . When selecting an expression system, researchers should consider factors such as post-translational modifications, protein folding, yield requirements, and compatibility with purification strategies.

How can researchers detect and quantify KCNE2 protein in guinea pig heart tissues?

Detection and quantification of KCNE2 protein in guinea pig heart tissues can be accomplished using validated antibodies in western blot analysis. Specifically, antibodies like Ab1 have been shown to effectively detect native KCNE2 proteins in guinea pig hearts. For quantitative analysis, band intensities can be normalized to loading controls such as actin. Subcellular localization studies can be performed using immunofluorescence with the same validated antibodies, which reveal preferential cell surface distribution of KCNE2 in cardiac myocytes . For gene expression analysis, researchers can employ RT-qPCR using guinea pig-specific primers: Forward primer 5'-AGAAACAAGGATGGCGTGGT-3' and Reverse primer 5'-CAAAGAGCTGCATGGATCGC-3', with GAPDH (Forward: 5'-GCGCCGAGTATGTAGTGGAA-3', Reverse: 5'-TGATTCACGCCCATCACGAA-3') serving as a normalization control .

What protein tags are recommended for recombinant guinea pig KCNE2 purification and detection?

For recombinant guinea pig KCNE2, the most commonly used tag is the histidine (His) tag, particularly for proteins expressed in yeast systems. This tag facilitates efficient purification using immobilized metal affinity chromatography (IMAC). When working with recombinant KCNE2 from other species, researchers have successfully employed various tags including His tag, Strep tag, and Myc-DYKDDDDK (FLAG) tag . The choice of tag should consider potential interference with protein function and structure. For functional studies, smaller tags like His are often preferred as they minimize structural alterations. For co-immunoprecipitation experiments or protein-protein interaction studies, epitope tags such as HA or FLAG may provide better specificity with commercial antibodies.

How does KCNE2 modulate potassium channel function in cardiac cells?

KCNE2 serves as a regulatory β subunit that modulates the function of various potassium channel α subunits through direct physical interactions. Studies have demonstrated that KCNE2 can significantly alter channel properties, including:

  • Voltage dependence: KCNE2 negative-shifts the voltage dependence of activation of the endothelial cell and cardiomyocyte-expressed Kv channel α subunit, Kv1.5.

  • Activation kinetics: KCNE2 increases the rate of activation of Kv1.5 channels.

  • Current amplitude regulation: KCNE2 can suppress hERG current amplitude through a post-translational mechanism that accelerates hERG protein degradation.

  • Differential effects on partner channels: While KCNE2 accelerates hERG protein degradation, it does not reduce Kv4.3 protein levels, instead modulating Kv4.3 gating kinetics by slowing time to peak and inactivation, and shifting voltage-dependence of activation and inactivation in the positive direction .

These modulatory effects highlight KCNE2's complex role in fine-tuning cardiac electrical activity through multiple mechanisms and interaction partners.

What is the significance of the KCNE2-Testin interaction in cardiac physiology?

The interaction between KCNE2 and Testin represents a novel molecular link between ion channel regulation and focal adhesion proteins that may have implications for coronary artery disease (CAD). Testin (encoded by the TES gene) is an endothelial cell-expressed, CAD-associated focal adhesion protein that has been identified as a high-confidence interaction partner for KCNE2 through yeast two-hybrid screening of adult and fetal human heart libraries using the KCNE2 intracellular C-terminal domain as bait .

Functionally, Testin nullifies KCNE2 effects on Kv1.5 voltage dependence and gating kinetics without directly altering Kv1.5 function itself. Interestingly, this inhibitory effect is selective, as Testin does not prevent KCNE2 regulation of KCNQ1 gating. This interaction reveals Testin as a tertiary ion channel regulatory protein that may participate in complex regulatory networks affecting both cellular adhesion and ion channel function . The KCNE2-Testin interaction could potentially influence arterial and myocyte physiology in ways relevant to CAD pathogenesis, representing an important area for future research.

How does phosphorylation affect KCNE2 function?

Phosphorylation plays a crucial role in regulating KCNE2 function, particularly at serine residue S98. Research has demonstrated that phosphorylation of S98 in KCNE2 is necessary for its effect on accelerating hERG protein degradation, which ultimately suppresses hERG current amplitude . This post-translational modification represents an important regulatory mechanism that can be detected using specific antibodies (such as Ab2) that recognize the phosphorylation status of this serine residue.

The phosphorylation-dependent regulation of KCNE2 adds another layer of complexity to its role in modulating cardiac ion channels and may represent a potential target for therapeutic interventions. Researchers investigating KCNE2 phosphorylation should consider using phospho-specific antibodies alongside phosphatase inhibitors during protein extraction to preserve the phosphorylation state for accurate analysis.

What are the key differences between guinea pig KCNE2 and KCNE2 from other species?

Guinea pig presents a unique model for studying KCNE2 function due to several distinctive characteristics:

  • Partner channel expression: Unlike rats and mice, guinea pig myocardium does not express Kv4, a canonical partner of KCNE2 that typically forms the transient outward K+ current (Ito). Despite this absence, guinea pigs still maintain robust expression of KCNE2, suggesting important roles beyond Kv4 modulation .

  • Expression pattern: Similar to rat and human hearts, guinea pig KCNE2 shows a ventricle-dominant expression pattern, with ventricular expression approximately twice that of atrial expression .

  • Molecular weight pattern: Guinea pig KCNE2 typically migrates as 32-kDa and 24-kDa bands on western blots, with occasionally a very faint 15-kDa band, similar to the pattern observed in rat ventricles .

  • Experimental value: The absence of Kv4 expression makes guinea pig a valuable system for investigating KCNE2 functions independent of effects attributed to Ito, allowing researchers to isolate other regulatory roles of KCNE2 in cardiac electrophysiology .

These species-specific differences highlight the importance of choosing appropriate animal models for investigating specific aspects of KCNE2 biology and extrapolating findings to human physiology.

How does the guinea pig model advance our understanding of KCNE2 function in human heart disease?

The guinea pig model offers unique advantages for translational research on KCNE2 function in human heart disease for several reasons:

  • Electrophysiological similarity: Guinea pig is widely used as an animal model for studying the rapid and slow delayed rectifier K+ channels (IKr and IKs), two major KCNE2 partner channels in the heart that are critically important in human cardiac repolarization .

  • Absence of confounding currents: The natural absence of Kv4 expression and Ito current in guinea pig myocardium allows researchers to study KCNE2 effects on action potential duration independent of Ito modulation, isolating its interactions with other channel types that are relevant to human cardiac electrophysiology .

  • Comparable expression patterns: The ventricle-dominant expression pattern of KCNE2 observed in guinea pigs mirrors that found in human hearts, supporting the translational relevance of findings from this model .

  • Disease modeling: Studies in guinea pigs have demonstrated that knockdown of cardiac accessory proteins that interact with KCNE2 can significantly prolong the cardiac action potential, providing insights into arrhythmia mechanisms that may be applicable to human disease .

These characteristics make the guinea pig model particularly valuable for investigating KCNE2's role in cardiac repolarization disorders and for screening potential therapeutic approaches targeting KCNE2-mediated cardiac electrical activity regulation.

How can researchers investigate KCNE2 protein turnover and stability?

To investigate KCNE2 protein turnover and stability, researchers can employ several complementary approaches:

  • Pulse-chase experiments: This technique allows tracking of protein synthesis and degradation rates. Studies have shown that KCNE2 itself is not rapidly degraded even while it accelerates the degradation of partner proteins like hERG. For pulse-chase experiments, cells expressing KCNE2 (alone or with partner channels) are metabolically labeled with radioactive amino acids for a short period ("pulse"), followed by incubation in non-radioactive medium ("chase"). Samples are collected at various time points, immunoprecipitated, and analyzed to determine protein half-life .

  • Cycloheximide chase assays: Treating cells with cycloheximide to inhibit new protein synthesis can reveal degradation kinetics of existing KCNE2 protein.

  • Proteasome and lysosome inhibitors: Using inhibitors like MG132 (proteasome) or chloroquine (lysosome) helps determine which degradation pathway is involved in KCNE2 turnover.

  • Western blot time course: Analyzing KCNE2 protein levels at different time points after transfection provides insights into stability. Studies have shown that KCNE2 protein levels remain well-maintained even by day 3 post-transfection, while it can accelerate the degradation of partner proteins like hERG .

These methods can help elucidate the mechanisms underlying KCNE2's remarkable stability and its differential effects on partner protein degradation.

What approaches can resolve contradictory data regarding KCNE2's effects on different potassium channels?

When facing contradictory data regarding KCNE2's effects on different potassium channels, researchers should implement a systematic approach:

  • Context-dependent analysis: KCNE2 exhibits distinct effects on different partner channels. For instance, it accelerates hERG protein degradation while modulating Kv4.3 gating kinetics without affecting its protein levels . These differential effects should be analyzed in the specific context of each channel type.

  • Phosphorylation status assessment: KCNE2's effects can be phosphorylation-dependent. For example, S98 phosphorylation is necessary for KCNE2-mediated acceleration of hERG degradation . Researchers should verify the phosphorylation status of KCNE2 when investigating its effects.

  • Protein-protein interaction mapping: KCNE2 functions can be modulated by tertiary regulatory proteins like Testin, which specifically nullifies KCNE2 effects on Kv1.5 but not on KCNQ1 . Co-immunoprecipitation experiments to identify interaction partners can help explain contradictory results.

  • Species-specific considerations: KCNE2 functions may vary between species. For example, guinea pig lacks Kv4 expression but maintains KCNE2 expression, suggesting species-specific roles . Studies should clearly specify the species origin of both KCNE2 and partner channels.

  • Expression system variables: Different expression systems may yield varying results. Comparative studies using multiple systems (HEK-293, COS-7, cardiomyocytes) can help identify system-specific artifacts versus genuine physiological effects.

This comprehensive approach can help reconcile apparently contradictory data and provide a more nuanced understanding of KCNE2's multifaceted regulatory roles.

What are the best experimental designs to study KCNE2 interactions with multiple partner proteins simultaneously?

To effectively study KCNE2 interactions with multiple partner proteins simultaneously, researchers should consider the following experimental design strategies:

Experimental Approach Table for Studying KCNE2 Multi-Protein Interactions

TechniqueApplicationAdvantagesLimitationsSpecial Considerations
Multi-color FRETReal-time visualization of protein interactions in living cellsAllows monitoring of multiple protein interactions simultaneously; spatial resolutionRequires fluorescent protein tagging; potential interference with protein functionUse small fluorescent tags; validate with complementary methods
Sequential co-immunoprecipitationIsolation of protein complexes containing multiple componentsCan identify higher-order complexes; relatively straightforwardMay disrupt weak interactions; limited to stable complexesUse gentle detergents; cross-linking may help preserve transient interactions
Proximity ligation assayDetection of protein interactions in native tissueHigh sensitivity; can detect endogenous proteins; spatial informationLimited to binary interactions per assayCan be combined with immunohistochemistry for cellular context
BioID or APEX2 proximity labelingIdentification of proteins in close proximity to KCNE2Captures transient interactions; works in native cellular environmentNon-specific labeling; requires fusion protein expressionTime-course experiments can help distinguish direct vs. indirect interactions
Quantitative mass spectrometryComprehensive analysis of KCNE2 interactomeUnbiased approach; can identify novel interaction partnersRequires significant sample amounts; technically demandingUse SILAC or TMT labeling for quantitative comparison
Split-luciferase complementationReal-time monitoring of protein interactionsHighly sensitive; suitable for high-throughput screeningMay miss interactions involving multiple proteinsDesign constructs to minimize steric hindrance

When implementing these approaches, researchers should systematically vary the expression levels of KCNE2 and its potential partners to mimic physiological ratios. Additionally, using guinea pig cardiac myocytes provides a unique advantage since they lack Kv4 expression, allowing researchers to study KCNE2 interactions with other partners without the confounding effects of Ito modulation . Finally, computational modeling can help integrate experimental data and predict the functional consequences of multiple simultaneous KCNE2 interactions on cardiac action potential morphology.

How does research on recombinant guinea pig KCNE2 inform therapeutic strategies for cardiac arrhythmias?

Research on recombinant guinea pig KCNE2 has significant implications for developing therapeutic strategies for cardiac arrhythmias through several mechanisms:

  • Target identification: KCNE2 modulates multiple cardiac potassium channels including IKr and IKs, which are critical for cardiac repolarization and are targets for anti-arrhythmic drugs. Guinea pig studies have revealed that KCNE2 is more abundant in ventricles than atria, suggesting chamber-specific therapeutic approaches might be needed .

  • Mechanistic insights: KCNE2 can suppress hERG current amplitude by accelerating hERG protein degradation, a mechanism dependent on S98 phosphorylation . This specific post-translational modification represents a potential drug target for modulating hERG function without directly blocking the channel, potentially avoiding some side effects of traditional hERG blockers.

  • Protein-protein interaction targets: The discovery of KCNE2-Testin interaction reveals potential for developing therapeutics targeting accessory protein interactions rather than the ion channels themselves . Such approaches might offer greater specificity by affecting only certain aspects of channel function.

  • Model system advantages: Guinea pig cardiac electrophysiology more closely resembles human cardiac electrophysiology than that of mice or rats, particularly regarding repolarizing currents. The absence of Ito in guinea pigs (similar to human ventricular endocardium) makes them valuable for studying drugs targeting IKr and IKs without confounding effects from Ito modulation .

These insights from guinea pig KCNE2 research are contributing to the development of next-generation anti-arrhythmic approaches that may offer improved efficacy and reduced side effects compared to current therapies.

What insights does KCNE2 research provide about coronary artery disease pathophysiology?

KCNE2 research has revealed unexpected connections to coronary artery disease (CAD) pathophysiology that extend beyond its traditional role in cardiac electrophysiology:

  • Genetic association: KCNE2 has been associated with CAD susceptibility in humans, suggesting a potential causative role in disease development. Understanding how KCNE2 variants contribute to CAD risk could help identify individuals most at risk and guide preventive strategies .

  • Novel protein interactions: The identification of Testin (encoded by TES) as a KCNE2 interaction partner creates a molecular link between ion channel regulation and focal adhesion proteins. Testin is itself a CAD-associated protein expressed in endothelial cells, suggesting KCNE2 may influence vascular function through this interaction .

  • Endothelial function: KCNE2 is expressed in endothelial cells and modulates endothelial Kv channel function. The KCNE2-Testin interaction may affect endothelial cell adhesion, migration, or signaling, processes critical to atherosclerosis development .

  • Translational significance: The guinea pig model, with its expression of KCNE2 in both cardiac and vascular tissues, provides a valuable system for investigating these functions in an integrated physiological context relevant to human disease .

Future studies focusing on the role of KCNE2-Testin interactions in arterial and myocyte physiology may reveal new therapeutic targets for CAD prevention or treatment, potentially addressing both the electrical and structural aspects of cardiovascular disease pathophysiology.

What emerging technologies might advance our understanding of KCNE2 function in the guinea pig model?

Several cutting-edge technologies hold promise for deepening our understanding of KCNE2 function in the guinea pig model:

  • CRISPR/Cas9 genome editing: The development of efficient CRISPR methods for guinea pig will enable precise modification of the KCNE2 gene to create knockout models or introduce specific mutations associated with human disease. This approach would overcome limitations of transient knockdown methods currently used .

  • Single-cell electrophysiology combined with optogenetics: Optogenetic control of KCNE2-expressing cells combined with patch-clamp recording would allow temporal precision in studying KCNE2's effects on cardiac electrical activity in specific cell populations.

  • Advanced imaging techniques: Super-resolution microscopy and expansion microscopy can reveal the nanoscale organization of KCNE2 and its partner channels in guinea pig cardiac myocytes, providing insights into how spatial organization affects function.

  • Cryo-electron microscopy: Structural determination of guinea pig KCNE2 in complex with its partner channels would reveal the molecular basis of its regulatory effects and potentially identify drug-binding pockets for therapeutic development.

  • Tissue-specific inducible expression systems: Developing guinea pig models with inducible, tissue-specific KCNE2 expression would allow temporal control over KCNE2 function to distinguish developmental versus acute effects.

  • Multiomics integration: Combining transcriptomics, proteomics, and metabolomics approaches in guinea pig models with altered KCNE2 function could reveal broader physiological impacts beyond direct channel modulation.

These technologies promise to overcome current limitations in studying KCNE2 biology and potentially reveal new therapeutic targets for cardiac arrhythmias and coronary artery disease.

What are the key unanswered questions about guinea pig KCNE2 that warrant further investigation?

Despite significant advances in KCNE2 research, several critical questions about guinea pig KCNE2 remain unanswered and merit further investigation:

  • Post-translational modifications: What accounts for the observed migration of native guinea pig KCNE2 as 24-kDa and 32-kDa bands rather than the expected 15-kDa core protein? While N-glycosylation has been ruled out, other modifications such as O-glycosylation or phosphorylation may be responsible .

  • Subcellular trafficking: What mechanisms control the preferential cell surface localization of KCNE2 in guinea pig cardiac myocytes, and how is this trafficking regulated under pathophysiological conditions?

  • Partner-specific regulation: Why does KCNE2 accelerate degradation of some partner proteins (like hERG) while only modulating the function of others (like Kv4.3) without affecting their stability ? Understanding this selectivity could reveal novel regulatory mechanisms.

  • Testin interaction: What is the physiological significance of the KCNE2-Testin interaction in guinea pig vascular and cardiac tissues, and how might this interaction contribute to coronary artery disease pathophysiology ?

  • Ventricle-atria gradient: What mechanisms establish and maintain the higher expression of KCNE2 in ventricles compared to atria in guinea pig hearts , and what are the functional consequences of this gradient?

  • Compensatory mechanisms: In the absence of Kv4 expression in guinea pig myocardium, what alternative partners does KCNE2 regulate to maintain cardiac electrical homeostasis ?

Addressing these questions will require multidisciplinary approaches combining molecular biology, electrophysiology, structural biology, and integrative physiology to fully elucidate the complex biology of KCNE2 in guinea pig and its relevance to human cardiovascular disease.

What is the current consensus on the most important functions of KCNE2 in guinea pig cardiac physiology?

The current consensus regarding guinea pig KCNE2 function highlights its multifaceted role in cardiac physiology beyond traditional views of potassium channel regulation. Research indicates that despite the absence of Kv4 channels (a canonical KCNE2 partner) in guinea pig myocardium, KCNE2 remains robustly expressed, emphasizing its importance in regulating other cardiac ion channels . KCNE2 shows preferential cell surface localization in both atrial and ventricular myocytes, with significantly higher expression in ventricular tissue—a pattern consistently observed across species including humans .

KCNE2 primarily functions as a regulatory β subunit for multiple cardiac potassium channels, including IKr and IKs, which are critical for cardiac repolarization. Its regulatory mechanisms extend beyond simple gating modifications to include post-translational control of channel protein stability, as demonstrated by its ability to accelerate hERG degradation through a phosphorylation-dependent mechanism . Additionally, the interaction between KCNE2 and Testin, a focal adhesion protein associated with coronary artery disease, suggests KCNE2 may form a molecular link between electrical activity and structural components in cardiac and vascular tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.