Recombinant Guinea pig T-cell surface glycoprotein CD1e, membrane-associated (CD1E)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Guinea Pig CD1e (CD1E) is a non-polymorphic glycoprotein belonging to the CD1 family, which specializes in presenting lipid antigens to T cells. In guinea pigs, CD1E is part of an extended group 1 CD1 gene family that includes homologs to human CD1a, CD1b, CD1c, and CD1e . Like other CD1 proteins, CD1E shares structural similarities with MHC class I molecules but differs in its ability to bind non-peptide antigens (e.g., lipids, glycolipids) .

Comparative Insights from Human CD1e

Human CD1e is primarily intracellular, localizing to lysosomes, and is thought to process lipid antigens for cross-presentation to T cells . While guinea pig CD1E may share this role, its precise biological significance remains speculative.

Recombinant CD1E Applications

Recombinant CD1E proteins (e.g., those produced via bacterial or mammalian expression systems) could theoretically enable:

  1. Structural Studies: X-ray crystallography to map its antigen-binding groove.

  2. Immune Assays: Testing lipid antigen specificity in vitro.

  3. Vaccine Development: Exploring CD1E-restricted T-cell responses for mycobacterial or autoimmune therapies.

Table 2: Potential Research Directions for CD1E

ApplicationMethodologyExpected Outcome
Structural analysisX-ray crystallographyResolution of CD1E’s lipid-binding groove geometry
Antigen identificationLipid library screeningIdentification of CD1E-specific lipid ligands
Immunogenicity testingT-cell assays with recombinant CD1ECharacterization of CD1E-restricted T-cell responses

Key Challenges

  • Reagent Availability: No monoclonal antibodies or recombinant proteins specific to guinea pig CD1E are commercially available, as evidenced by the absence of CD1E in product catalogs .

  • Functional Redundancy: Overlap in lipid antigen presentation by CD1b and CD1c may obscure CD1E’s unique role.

Recommendations

  1. Targeted Gene Knockout Studies: Assess CD1E’s role in mycobacterial immunity.

  2. Cross-Species Comparisons: Leverage human CD1e data to hypothesize guinea pig CD1E functions.

  3. Proteomic Profiling: Identify CD1E-associated lipids in infected guinea pigs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CD1E; T-cell surface glycoprotein CD1e, membrane-associated; mCD1e; CD antigen CD1e
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-390
Protein Length
Full Length of Mature Protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
EEPLIFRLLHIASFKNHSWSHSQASAWIGDLQTHGWNSTMGTIQFLKPWSQGDFSKEELK NFEALFRLYFHDFPREVHAFAHQFQFEYPFELQISGGCKNVGKTSENFLNGAYQGSDLLS FQRSSWEPSPGAGSRAQKVCEVLSYYKDITEIVQSLLSSVCPRFLSGLIAAGKSELERQV KPEVWLSRGPSPGRGRLQLVCHVSGFHPKPVWVMWMKGQQEQKGTKTGDIPNADETWYLQ ATLDVAEREATGLSCRVKHSSLGGHDIIIHWGGYSILLILMYVAVIVTLVTLIVMGSWHR KQSSNRNVLSSYISNPTFPLENDTQCPRSSALQLHSAQESWIKNRILKWKRSLNQFW
Uniprot No.

Target Background

Function

Recombinant Guinea pig T-cell surface glycoprotein CD1e, membrane-associated (CD1E), is essential for glycolipid antigen presentation on the cell surface. The membrane-bound form is inactive.

Database Links
Subcellular Location
[T-cell surface glycoprotein CD1e, membrane-associated]: Golgi apparatus membrane; Single-pass type I membrane protein. Early endosome. Late endosome. Note=Predominantly localized in the trans-Golgi network in immature dendritic cells, and as a cleaved, soluble protein in the lysosome lumen of mature dendritic cells.; [T-cell surface glycoprotein CD1e, soluble]: Lysosome lumen.

Q&A

What is the composition of the CD1 gene family in guinea pigs and how does CD1e fit within this family?

Guinea pigs (Cavia porcellus) possess a complex CD1 multigene family consisting of eight distinct CD1 transcripts. Sequence analysis of these cDNA clones reveals that guinea pig CD1 proteins include four homologues of human CD1b, three homologues of human CD1c, and a single CD1e homologue. These guinea pig CD1 proteins contain conserved amino acid residues and hydrophobic domains within the putative antigen binding pocket, demonstrating evolutionary conservation of critical functional regions .

The guinea pig CD1e is specifically characterized as a protein that does not directly interact with the T-cell receptor but instead participates in the presentation of lipid antigens by other CD1 molecules. This functional specialization distinguishes CD1e from other CD1 family members and highlights its unique role in immune response regulation .

How is CD1e expressed and distributed in guinea pig tissues?

CD1e expression in guinea pig tissues follows a pattern similar to that observed in other mammals. Using monoclonal antibodies that cross-react with guinea pig CD1 isoforms, researchers have detected cell-surface expression on:

  • Cortical thymocytes

  • Dermal dendritic cells in the skin

  • Follicular dendritic cells in lymph nodes

  • B cell regions within lymph nodes and spleen

  • A subset of peripheral blood mononuclear cells (PBMCs), consistent with expression on circulating B cells

This tissue distribution suggests that CD1e is strategically positioned in various lymphoid and non-lymphoid tissues to participate in immune surveillance and antigen presentation processes.

What is the primary functional role of CD1e in lipid antigen processing and presentation?

CD1e functions as a lipid transfer protein that assists in both loading and unloading of lipid antigens on other CD1 molecules. Unlike other CD1 family members, CD1e does not directly present antigens to T cells but instead modulates the presentation activities of CD1b, CD1c, and CD1d .

Specifically, CD1e:

  • Binds lipids in lysosomes

  • Facilitates processing of complex glycolipids

  • Promotes editing of lipid antigens

  • Influences the formation and persistence of CD1-lipid complexes

  • Affects both the magnitude and temporal dynamics of CD1-restricted immune responses

These functions establish CD1e as a critical regulator of lipid antigen presentation, capable of fine-tuning immune responses to both self and foreign lipid antigens.

How does recombinant CD1e influence the loading and unloading kinetics of lipid antigens on other CD1 molecules?

Recombinant CD1e demonstrates bidirectional effects on lipid antigen presentation by modulating both loading and unloading kinetics of CD1-lipid complexes. Experimental evidence from plate-bound CD1d-based lipid presentation assays shows that CD1e:

  • Accelerates formation of stimulatory complexes: CD1e expression induced rapid IL-4 release from T cells at just 4 hours after α-GalCer pulsing, while without CD1e, cytokine release was only observed after 8 hours .

  • Enhances lipid loading efficiency: In direct loading assays, recombinant CD1e significantly enhanced T-cell activation and demonstrated greater efficiency than several saposin proteins (B and C) that are known lipid transfer molecules .

  • Promotes complex turnover: CD1e induces faster reduction of stimulatory capacity at later time points (24-48 hours), suggesting it also facilitates unloading of lipid antigens from CD1 molecules .

These kinetic effects enable CD1e to modulate both the magnitude and duration of lipid-specific immune responses, providing a sophisticated regulation mechanism for CD1-restricted T cell activation.

What methodologies are most effective for studying CD1e interactions with other CD1 molecules and lipid antigens?

Several complementary methodologies have proven effective for investigating CD1e interactions:

Antigen Presentation Assays:

  • Autoreactive T cell stimulation: Using increasing numbers of antigen-presenting cells (APCs) without exogenous antigen addition allows assessment of CD1e's impact on presentation of endogenous lipids .

  • Exogenous antigen assessment: Preincubating transfectants (0.5 × 10^5 cells/well), mouse thymocytes (5 × 10^5 cells/well), or dendritic cells (10^5 cells/well) with antigens before adding T cells enables quantification of CD1e's effect on specific lipid presentation .

  • Pulse-chase experiments: Pulsing APCs with α-GalCer, washing, and chasing before adding T cells allows temporal analysis of CD1e's effects on antigen processing and presentation .

CD1d Loading and Unloading Experiments:

  • Plate-bound assays: Coating plates with anti-CD1d antibodies and adding soluble recombinant CD1d, followed by lipid antigens with or without recombinant CD1e, enables direct assessment of CD1e's lipid transfer capacity .

  • Cytokine measurement: Quantifying released cytokines (GM-CSF, IL-4, IL-2, IFN-γ) by ELISA provides functional readouts of T cell activation influenced by CD1e .

  • Isoelectric focusing (IEF) analysis: This technique allows direct visualization of CD1d loading and unloading influenced by CD1e .

These methodological approaches provide complementary insights into CD1e's multifaceted roles in lipid antigen presentation.

How does CD1e expression modulate cytokine production profiles in CD1-restricted T cell responses?

CD1e expression differentially affects the cytokine profile produced by CD1-restricted T cells, particularly invariant Natural Killer T (iNKT) cells. This differential modulation reflects CD1e's capacity to fine-tune the immune response:

  • IFN-γ production: CD1e expression causes marked reduction in IFN-γ release by iNKT cells stimulated with exogenous antigens, indicating a strong modulatory effect on Th1-type responses .

  • IL-4 production: CD1e expression leads to moderate reduction in IL-4 release, suggesting a less pronounced effect on Th2-type responses .

  • GM-CSF production: CD1e has minimal effect on GM-CSF release, indicating differential thresholds for cytokine production regulation .

These differential effects were observed with multiple antigen-presenting cell types (THP-1 and C1R transfectants), confirming that this is an intrinsic property of CD1e rather than a cell-specific phenomenon. The mechanism likely involves CD1e modulating the number and stability of CD1-lipid complexes, which affects TCR signal strength and subsequent cytokine production patterns .

This cytokine modulation represents a sophisticated mechanism whereby CD1e can shift immune responses from pro-inflammatory to regulatory phenotypes depending on the context.

What are the optimal conditions for producing functional recombinant guinea pig CD1e protein?

For producing functional recombinant guinea pig CD1e, researchers should consider the following methodological approach:

  • Expression System Selection: Mammalian expression systems are generally preferred over bacterial systems to ensure proper protein folding and post-translational modifications essential for CD1e functionality.

  • Construct Design: Based on analysis of CD1e sequences from guinea pig cDNA libraries, constructs should include:

    • Complete open reading frame of guinea pig CD1e

    • Appropriate signal sequence for secretion

    • Purification tag (e.g., histidine tag) for downstream isolation

    • Optional soluble version lacking the transmembrane domain for certain applications

  • Purification Strategy: Multi-step purification typically yields the most functional protein:

    • Initial affinity chromatography using the purification tag

    • Further refinement via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

    • Validation of purity using isoelectric focusing techniques as described in CD1e research

  • Functional Validation: Recombinant CD1e should be validated through:

    • Lipid binding assays to confirm interaction with relevant lipid antigens

    • CD1d loading/unloading experiments as described in the literature

    • T cell stimulation assays to confirm biological activity

These conditions ensure production of recombinant guinea pig CD1e that maintains its natural lipid binding and transfer capabilities essential for research applications.

How can researchers develop transgenic mouse models expressing guinea pig CD1e to study its function in vivo?

Developing transgenic mouse models expressing guinea pig CD1e requires careful consideration of several factors:

  • Construct Design:

    • Guinea pig CD1e cDNA should be cloned downstream of an appropriate promoter that drives expression in relevant immune cells (e.g., CD11c promoter for dendritic cell expression)

    • Consider adding a reporter gene (e.g., GFP) to monitor transgene expression

    • Include species-specific regulatory elements to ensure proper expression patterns

  • Transgenic Approach Selection:

    • Conventional transgenic approach: Injection of linearized construct into fertilized oocytes for random integration

    • Site-directed knock-in: CRISPR/Cas9-mediated insertion at a specific locus for controlled expression

    • Conditional expression systems (e.g., tetracycline-inducible) for temporal control of CD1e expression

  • Validation of Transgenic Lines:

    • Confirm CD1e expression using flow cytometry and immunohistochemistry

    • Verify tissue distribution mirrors that observed in guinea pigs

    • Assess functional capacity using lipid antigen presentation assays

    • Perform comparative studies between CD1e-expressing and wild-type mice to identify phenotypic differences

  • Experimental Applications:

    • Study CD1e effects on iNKT cell activation using α-GalCer and other lipid antigens

    • Investigate responses to bacterial-derived lipids, as CD1e has been shown to modulate early responses to these antigens

    • Examine cytokine profiles and immunological outcomes in infection models

Research has demonstrated that mouse models expressing CD1e show accelerated formation of CD1d-lipid complexes and more rapid turnover compared to wild-type animals, making them valuable tools for studying CD1e biology .

What are the critical controls needed when assessing CD1e's effect on lipid antigen presentation?

When designing experiments to assess CD1e's effect on lipid antigen presentation, several critical controls are essential:

  • Expression Level Controls:

    • Include transfectants expressing equal levels of CD1 molecules with and without CD1e

    • Quantify surface expression by flow cytometry to ensure comparable presentation capacity

    • Documented evidence shows researchers should choose transfectants with equivalent CD1 expression levels before testing CD1e effects

  • Antigen-Specific Controls:

    • Test multiple lipid antigens including:

      • Self-antigens (e.g., gangliosides, sulfatides)

      • Microbial lipids (e.g., mycobacterial lipids)

      • Synthetic lipid analogs (e.g., α-GalCer)

    • Include dose-response curves to identify concentration-dependent effects

    • Research demonstrates CD1e effects vary dramatically depending on the specific lipid antigen tested

  • Temporal Controls:

    • Implement pulse-chase experiments to distinguish between effects on loading versus unloading

    • Fix antigen-presenting cells at different time points to capture dynamic changes

    • Include both short-term (4-8h) and long-term (24-48h) measurements, as CD1e shows different effects at different time points

  • Functional Outcome Controls:

    • Measure multiple cytokines (IFN-γ, IL-4, GM-CSF) to capture differential effects

    • Include both autoreactive and antigen-specific T cell clones

    • Compare different types of CD1-restricted T cells (iNKT cells, type 2 NKT cells, CD1b-restricted T cells)

By incorporating these controls, researchers can properly attribute observed effects specifically to CD1e function rather than experimental artifacts or confounding variables.

How does CD1e's lipid editing function influence responses to bacterial pathogens?

CD1e plays a nuanced role in regulating immune responses to bacterial pathogens through its lipid editing functions:

  • Processing of Complex Bacterial Glycolipids:
    CD1e facilitates the conversion of complex phosphatidylinositol hexamannosides (PIM6) from Mycobacterium tuberculosis into simpler dimannosylated forms (PIM2) that are more stimulatory to CD1b-restricted T cells. This processing function enables more efficient recognition of mycobacterial lipid antigens .

  • Temporal Modulation of Bacterial Lipid Responses:
    Research with Sphingomonas paucimobilis-derived lipid antigens demonstrates that CD1e significantly enhances early iNKT cell responses (12-24 hours post-infection) but this enhancing effect disappears after 48 hours. This temporal regulation is critical for proper innate immune function during the initial stages of bacterial infection .

  • Bacterial Antigen Availability:
    CD1e affects the availability of bacterial lipid antigens by:

    • Accelerating the formation of stimulatory CD1-lipid complexes

    • Enhancing the turnover of these complexes

    • Fine-tuning the duration of T cell stimulation

These mechanisms allow CD1e to maximize the efficiency of early immune responses to bacterial pathogens while preventing excessive inflammation by limiting the persistence of stimulatory complexes. This dual functionality makes CD1e particularly important in orchestrating balanced responses to bacterial infections.

What is the relationship between CD1e polymorphisms and susceptibility to mycobacterial infections in guinea pig models?

While the search results don't directly address CD1e polymorphisms in guinea pigs, we can extrapolate from CD1e's known functions to understand potential relationships with mycobacterial infection susceptibility:

  • Lipid Antigen Processing Capacity:
    CD1e facilitates processing of mycobacterial phosphatidylinositol mannosides, converting PIM6 into the more stimulatory PIM2 form. Polymorphisms affecting this processing function could conceivably alter the efficiency of T cell responses to mycobacterial lipids .

  • T Cell Response Regulation:
    CD1e's demonstrated ability to both enhance and inhibit CD1-restricted T cell responses suggests that polymorphic variants might shift the balance between protective immunity and immunopathology during mycobacterial infection .

  • Cytokine Modulation:
    Since CD1e differentially affects cytokine production (particularly IFN-γ, which is critical for anti-mycobacterial immunity), polymorphisms could potentially alter cytokine profiles during infection and impact disease outcomes .

  • Complex Formation Kinetics:
    CD1e accelerates both the formation and turnover of CD1-lipid complexes. Polymorphisms affecting these kinetics could influence the speed and duration of T cell responses to mycobacterial lipids .

Research using guinea pig CD1e in experimental models would be valuable to determine whether natural polymorphisms in this population influence susceptibility to mycobacterial diseases through these or other mechanisms.

How can the lipid transfer properties of CD1e be harnessed for vaccine adjuvant development?

CD1e's unique lipid transfer properties present compelling opportunities for vaccine adjuvant development:

  • Enhanced Lipid Antigen Loading:
    Recombinant CD1e demonstrates superior ability to facilitate loading of lipid antigens onto CD1d compared to other lipid transfer proteins like saposins. This property could be exploited to enhance loading of adjuvant lipids onto CD1 molecules, potentially improving vaccine efficacy .

  • Temporal Control of Immune Responses:
    CD1e's ability to accelerate both formation and turnover of CD1-lipid complexes allows for precise temporal control of innate-like T cell activation. This could be leveraged to:

    • Create adjuvants that provide a strong but self-limiting initial immune activation

    • Reduce the risk of prolonged inflammation associated with traditional adjuvants

    • Enable pulsed immune stimulation strategies

  • Cytokine Profile Modulation:
    CD1e differentially affects cytokine production, with stronger inhibition of IFN-γ than IL-4. This property could be used to design adjuvants that preferentially induce Th1 or Th2 responses depending on the desired vaccine outcome .

  • Application Strategies:
    Potential approaches include:

    • Co-administration of recombinant CD1e with lipid adjuvants

    • Development of fusion proteins linking CD1e to specific lipid antigens

    • Creation of nanoparticles incorporating both CD1e and lipid adjuvants

    • Engineering of antigen-presenting cells to overexpress CD1e during vaccine delivery

The ability of CD1e to fine-tune lipid-specific immune responses provides a sophisticated tool for developing next-generation vaccine adjuvants with improved specificity and reduced side effects.

How does guinea pig CD1e structure and function compare to human and other mammalian CD1e proteins?

A comparative analysis of CD1e across species reveals important structural and functional relationships:

  • Sequence Homology and Classification:
    Guinea pig CD1e shows closest homology to human CD1e, allowing its classification within the CD1 family. The guinea pig CD1 family includes a single CD1e homologue, similar to humans, suggesting evolutionary conservation of this specialized molecule .

  • Functional Conservation:
    Despite some sequence differences, the core functions of CD1e appear conserved between guinea pigs and humans:

    • Both act as lipid transfer proteins rather than direct antigen presenters

    • Both facilitate processing of complex glycolipids

    • Both modulate presentation by other CD1 molecules

  • Tissue Distribution:
    The expression pattern of CD1e in guinea pig tissues mirrors that seen in other mammals, with presence in:

    • Thymocytes

    • Dendritic cells

    • Langerhans cells

    • Lymphoid tissues

  • Structural Conservation:
    Guinea pig CD1e contains conserved amino acid residues and hydrophobic domains within the putative antigen binding pocket, suggesting preservation of lipid-binding capabilities across species .

This cross-species conservation makes guinea pig CD1e a valuable model for studying CD1e biology with potential translational relevance to human immune function.

What experimental challenges exist when working with recombinant guinea pig CD1e compared to human CD1e?

Researchers face several specific challenges when working with recombinant guinea pig CD1e:

  • Reagent Availability:

    • Limited availability of guinea pig-specific antibodies and reagents compared to human systems

    • Need to rely on cross-reactive antibodies, such as anti-human CD1b antibodies that have been shown to cross-react with guinea pig CD1 molecules

    • Fewer validated detection systems for guinea pig cytokines and T cell responses

  • Expression System Optimization:

    • Species-specific glycosylation patterns may require careful selection of expression systems

    • Post-translational modifications critical for CD1e function may differ between species

    • Solubility challenges may arise due to the hydrophobic nature of CD1e's lipid-binding domains

  • Functional Assay Development:

    • Need to establish guinea pig-specific T cell clones and lines for functional studies

    • Adaptation of human assay systems (like plate-bound CD1d assays) for guinea pig proteins

    • Validation that lipid binding properties are maintained in recombinant systems

  • Experimental Controls:

    • Ensuring proper folding and functionality of recombinant protein

    • Demonstrating species-specific lipid binding preferences

    • Confirming that observed effects are CD1e-specific rather than artifacts of the expression system

Addressing these challenges requires careful experimental design and validation, but the resulting insights can provide valuable comparative data on CD1e biology across species.

How can structural insights from recombinant guinea pig CD1e inform the design of lipid-based therapeutics?

Structural insights from recombinant guinea pig CD1e can inform therapeutic design in several ways:

  • Lipid Binding Pocket Characterization:
    The guinea pig CD1e antigen binding pocket contains conserved amino acid residues and hydrophobic domains that define its lipid specificity . Understanding these structural features can guide:

    • Design of lipid-based drugs with optimal binding characteristics

    • Development of lipid analogs that leverage CD1e's transfer capabilities

    • Creation of competitive inhibitors to modulate CD1e function in disease states

  • Lipid Transfer Mechanism Insights:
    CD1e's demonstrated ability to facilitate both loading and unloading of lipids from other CD1 molecules provides a model for:

    • Designing lipid carriers with controlled release properties

    • Creating lipid delivery systems that target specific CD1-expressing cell types

    • Developing compounds that selectively modulate lipid presentation kinetics

  • Species-Comparative Approach:
    Comparing guinea pig CD1e structure with human CD1e can:

    • Identify conserved features essential for function

    • Highlight species-specific differences that may impact therapeutic translation

    • Provide insights into evolutionary adaptation of lipid recognition systems

  • Therapeutic Targeting Strategies:
    Structural analysis can inform:

    • Development of antagonists that block CD1e's lipid transfer function

    • Creation of agonists that enhance specific aspects of CD1e activity

    • Design of fusion proteins linking CD1e functional domains to targeting moieties

These structure-function insights from guinea pig CD1e research can accelerate the development of novel immunomodulatory therapies targeting lipid antigen presentation pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.