Recombinant Guinea pig Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Characterization

The Recombinant Guinea pig AGTR1 corresponds to the angiotensin II type 1 receptor, a G-protein coupled receptor (GPCR) encoded by the AGTR1 gene. It binds angiotensin II, a peptide hormone critical for blood pressure regulation, fluid balance, and cellular growth . Key features include:

  • Gene Location: Chromosome 3 (Guinea pig homolog) .

  • Structure: Seven transmembrane domains with extracellular N-terminal and intracellular C-terminal regions .

  • Expression System: Produced in E. coli for in vitro studies (e.g., product code CSB-CF895758GU) .

Functional and Signaling Pathways

AGTR1 activation triggers multiple downstream pathways:

  • PI3K/Akt and MAPK: Mediates cell proliferation and survival .

  • PLC-β/Inositol Triphosphate: Increases intracellular calcium, influencing vascular contraction .

  • JAK/STAT: Linked to inflammatory responses and fibrosis .

Guinea pig AGTR1 exhibits unique binding kinetics compared to human and rodent homologs. Saturation-binding assays reveal two affinity states (high: Kd=1.63.6 nMK_d = 1.6-3.6 \ \text{nM}, low: Kd=300433 nMK_d = 300-433 \ \text{nM}) in cardiac tissues .

Cardiovascular Studies

  • Guinea pigs lack angiotensin II-induced inotropic responses despite expressing functional AGTR1 receptors, making them valuable for studying receptor-ligand interactions without confounding cardiac effects .

  • Recombinant AGTR1 enables in vitro analysis of angiotensin II signaling in vascular smooth muscle and renal cells .

Disease Models

  • Hypertension: AGTR1 antagonists (e.g., Captopril ) are tested for blood pressure modulation.

  • Tuberculosis: Guinea pig AGTR1 is indirectly studied in pulmonary granuloma models to assess systemic inflammation .

Key Products

Product CodeSourceApplication
CSB-CF895758GUE. coliLigand-binding assays
CSB-YP895758GU1YeastStructural studies
CSB-EP895758GU1-BBiotinylatedImmunoprecipitation

Antibody Validation

Antibody CodeHostValidated Applications
SAB3500209RabbitWB, IF, IHC (Human, Mouse)
ZRB2442RabbitWB, ICC (Bovine, Canine)

Comparative Analysis with Other Species

SpeciesAGTR1 FunctionKey Differences
HumanMediates pressor responseSingle receptor type (no AGTR1B)
MouseAT1A/AT1B subtypesHigher baseline expression
Guinea PigNo inotropic effectUnique binding kinetics

Therapeutic Implications

  • Hypertension: AGTR1 blockers reduce blood pressure by inhibiting angiotensin II-induced vasoconstriction .

  • Cancer: Overexpression in tumors suggests AGTR1 as a target for antiproliferative therapies .

Limitations and Future Directions

  • Guinea pig AGTR1’s lack of inotropic response limits direct cardiac studies .

  • Further structural studies using recombinant proteins (e.g., CSB-EP895758GU1) could elucidate species-specific signaling mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MILNSSTEDGIKRIQDDCPKAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADICFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCVIIWLMAGLASLPAVIHRNVFFIENTNITVC AFHYESQNSTLPIGLGLTKNILGFMFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKISDIVDTAMPITICIAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSTLSTKMSTLSYRPSDNVSSSAKKPVQCFEVE
Uniprot No.

Target Background

Function
Receptor for angiotensin II. It mediates its action by associating with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Results implicate the AT(1) receptor and tyrosine kinases in the hyposmotic modulation of atrial I (Ks) and suggest acute antiarrhythmic properties of AT(1) antagonists in settings of stretch-related atrial tachyarrhythmias. PMID: 19404674
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AGTR1 and what is its functional significance in guinea pig models?

AGTR1 (Angiotensin II Receptor 1) is a critical receptor involved in the regulation of blood pressure, fluid and electrolyte balance, and cell growth and differentiation through its interaction with angiotensin II. In guinea pig models, AGTR1 plays significant roles in cardiovascular function and placental development . The receptor activates multiple signal transduction pathways including PI3K/Akt and Ras/MAPK when bound by angiotensin II .

Guinea pig AGTR1 serves as an important model for studying the renin-angiotensin system (RAS) in physiological contexts due to similarities with human AGTR1 expression patterns. Research indicates that AGTR1 expression in guinea pigs is variable across different tissue types, with notable expression in placental tissues during pregnancy where it may influence fetal development .

What alternative nomenclature exists for guinea pig AGTR1 in scientific literature?

In scientific literature and commercial resources, guinea pig AGTR1 is referenced under several alternative names which researchers should be aware of when conducting literature searches:

  • AT1R

  • AG2S

  • AG2-S

  • AGTR1A

  • AGTR1B

  • AT1

  • AT1B

  • AT2R

This variation in nomenclature reflects both historical naming conventions and the identification of receptor subtypes. When searching databases or literature, researchers should include these alternative designations to ensure comprehensive results.

What are the basic characteristics of commercially available guinea pig AGTR1 detection kits?

Commercial ELISA kits for guinea pig AGTR1 typically employ the sandwich enzyme immunoassay principle. In this approach, microtiter plates are pre-coated with an antibody specific to guinea pig AGTR1. After adding samples, a biotin-conjugated antibody specific to AGTR1 is introduced, followed by avidin conjugated to horseradish peroxidase (HRP). The addition of TMB substrate solution produces a color change in wells containing AGTR1, which is then measured spectrophotometrically at approximately 450nm .

Key characteristics of typical guinea pig AGTR1 ELISA kits include:

ParameterSpecification
Detection Range0.16-10 ng/mL
Sensitivity0.051 ng/mL
Standard Concentration10 ng/mL
UniProt IDQ9WV26
Sample Types CompatibleTissue homogenates and other biological fluids
Recovery Range81-105% (depending on matrix)
Intra-Assay PrecisionCV<8%
Inter-Assay PrecisionCV<10%

How do maternal insulin-like growth factors affect AGTR1 expression in guinea pig placenta?

Research has demonstrated a significant interaction between insulin-like growth factors (IGFs) and the renin-angiotensin system in guinea pig pregnancy models. In a controlled study where guinea pigs were infused with IGF1, IGF2, or (Leu27)IGF2 from day 20 of pregnancy, IGF2 treatment specifically increased placental expression of AGTR1 by 88% (p=0.03) compared to vehicle-treated controls when measured at day 35 .

Interestingly, IGF2 treatment simultaneously decreased angiotensinogen (AGT) expression by 73% (p=0.01). Both IGF1 and IGF2 increased the ratio of active to total placental renin protein by approximately 22% (p=0.026 and p=0.038, respectively) at day 35 but not at day 62 of gestation . These findings suggest that IGF2 specifically modulates the placental RAS in early to mid-gestation, with potential implications for placental development and fetal growth.

At day 62 (late pregnancy), IGF2-treated mothers showed remarkably increased total plasma renin (+495%) and active renin (+359%) compared to vehicle controls, though the ratio of active to total renin decreased by 41% (p=0.042) . This demonstrates that growth factor interventions can have sustained effects on the RAS system throughout pregnancy.

What methodological approaches are most effective for generating recombinant antibodies to guinea pig AGTR1?

Generating recombinant antibodies to guinea pig AGTR1 can be effectively accomplished through phage display technology following immunization of guinea pigs. The methodology involves:

  • Immunization with a peptide segment of the target receptor (e.g., AGTR1)

  • Recovery of immunoglobulin variable heavy chain (VH) and light chain (VL) regions from the immunized guinea pig

  • RNA extraction from spleen B cells followed by cDNA preparation using RT-PCR

  • Amplification of VH and VL regions using degenerate primers designed based partially on human antibody sequences and partially on cloned guinea pig Ig sequences

  • Construction of a phage-display library by transferring the VH and VL regions into a phagemid vector

  • Affinity selection of the phage-display library using a biotinylated peptide segment of the target receptor

  • Isolation and characterization of specific antibody fragments that bind to the target receptor

This approach has been successfully applied to generate antibodies against receptors similar to AGTR1. The binding activity of selected clones to functional receptors provides the ability to target tissues expressing the receptor of interest in vivo .

What are the challenges in interpreting AGTR1 expression data in guinea pig disease models?

Interpreting AGTR1 expression data in guinea pig disease models presents several challenges that researchers should account for:

  • Sample preparation variability: Different tissue preparation methods can affect AGTR1 recovery and detection. Recovery studies show variation depending on the biological matrix (81-97% for serum, 90-105% for EDTA plasma, and 87-97% for heparin plasma) .

  • Linearity considerations: When diluting samples, researchers must consider the linearity of the assay. Data indicates that sample dilutions from 1:2 to 1:16 typically maintain linearity within 81-105% of expected values, depending on the sample type .

  • Experimental model variations: In disease models such as allergic airway inflammation, variable expression of AGTR1 may occur. For example, in the guinea pig model of concurrent allergic rhinitis and asthma, expression patterns may be altered, complicating interpretation of AGTR1's role in the disease process .

  • Exclusion criteria for model validation: When establishing disease models in guinea pigs where AGTR1 may play a role, researchers need to establish clear exclusion criteria. For instance, in allergy models, excluding guinea pigs with negative cutaneous reactions or insufficient symptom scores helps ensure the validity of subsequent expression analyses .

What is the optimal sandwich ELISA protocol for detecting guinea pig AGTR1 in various tissue samples?

The optimal sandwich ELISA protocol for detecting guinea pig AGTR1 involves several critical steps that must be carefully executed to ensure accurate results:

  • Plate preparation: Use pre-coated microplates with antibodies specific to guinea pig AGTR1.

  • Sample preparation: Prepare tissue homogenates or biological fluids according to standardized protocols, maintaining consistent protein concentrations.

  • Standard curve preparation: Prepare a serial dilution of the recombinant guinea pig AGTR1 standard (typically 10 ng/mL) to establish a range from 0.16-10 ng/mL.

  • Assay procedure:

    • Add 100 μL of prepared standards or samples to appropriate wells

    • Add biotin-conjugated antibody specific to guinea pig AGTR1

    • Add avidin conjugated to HRP

    • Add TMB substrate solution

    • Add stop solution (typically sulphuric acid)

    • Measure absorbance at 450nm ± 10nm wavelength

  • Data analysis: Plot the standard curve and determine sample concentrations by comparing optical density values to the standard curve .

For optimal results, researchers should ensure:

  • Consistent incubation times and temperatures

  • Thorough washing between steps

  • Fresh preparation of reagents

  • Sample dilutions within the linear range of the assay (typically 1:2 to 1:16 dilutions maintain 81-105% recovery)

How can differential expression of AGTR1 be accurately quantified in guinea pig tissue samples?

Accurate quantification of differential AGTR1 expression in guinea pig tissue samples requires a multi-faceted approach:

  • RNA-based quantification:

    • Extract total RNA from tissue samples using standardized protocols

    • Perform reverse transcription to obtain cDNA

    • Use specific primers designed for guinea pig AGTR1

    • Conduct quantitative real-time PCR (qRT-PCR) with appropriate reference genes

    • Apply the comparative Ct method (2^-ΔΔCt) for relative quantification

  • Protein-based quantification:

    • ELISA-based detection using commercial kits with established sensitivity (0.051 ng/mL) and range (0.16-10 ng/mL)

    • Western blot analysis using specific antibodies (such as guinea pig AGTR1 recombinant monoclonal antibodies)

    • For Western blot: load equal protein amounts, validate with positive controls (e.g., Hela, Raji, or MCF-7 whole cell lysates), use appropriate secondary antibodies, and look for the expected 42 kDa band

  • Normalization and controls:

    • Normalize expression to appropriate housekeeping genes (for RNA) or total protein content (for protein quantification)

    • Include positive and negative controls in each experiment

    • Account for tissue-specific variations in expression levels

  • Statistical analysis:

    • Apply appropriate statistical tests based on experimental design

    • Account for inter-assay variations (CV<10%) and intra-assay variations (CV<8%)

    • Consider potential confounding factors such as age, sex, and physiological state of the animals

What experimental controls are essential when studying AGTR1 function in guinea pig models?

When studying AGTR1 function in guinea pig models, several essential experimental controls must be incorporated:

  • Negative controls:

    • Vehicle-treated animals/samples for comparison with experimental groups

    • Normal saline plus Al(OH)₃ gel treatments (in sensitization studies)

    • Non-transfected cell lines (in cellular studies)

    • Isotype control antibodies (in immunological detection)

  • Positive controls:

    • Known AGTR1-expressing tissues or cell lines (such as Hela, Raji, or MCF-7 whole cell lysates)

    • Purified recombinant guinea pig AGTR1 proteins (for quantification studies)

    • Angiotensin II-treated samples (for functional assays)

  • Validation controls:

    • Cutaneous provocation tests to identify appropriately sensitized animals in disease models

    • Active cutaneous anaphylaxis (ACA) test for validating animal models

    • Evans blue dye quantification for vascular permeability studies

    • Histopathology evaluations to confirm tissue responses

  • Treatment controls:

    • Dose-response curves for any treatments affecting AGTR1

    • Time-course studies to determine optimal treatment durations

    • Antagonist controls (specific AGTR1 blockers) to confirm receptor-specific effects

  • Technical controls:

    • Multiple technical replicates for each biological sample

    • Inter-assay calibrators to normalize between experimental runs

    • Linearity dilution tests to ensure assay performance within the dynamic range

How should researchers interpret variable recovery rates in AGTR1 detection across different sample matrices?

Researchers must carefully interpret variable recovery rates when detecting AGTR1 across different biological matrices:

The recovery rates for guinea pig AGTR1 show matrix-dependent variation:

MatrixRecovery Range (%)Average Recovery (%)
Serum (n=5)81-97%89%
EDTA Plasma (n=5)90-105%97%
Heparin Plasma (n=5)87-97%90%

To accurately interpret these variations:

  • Incorporate matrix-specific calibration: Generate standard curves in the same biological matrix as the samples being tested to account for matrix effects.

  • Apply recovery correction factors: Calculate matrix-specific correction factors based on recovery experiments and apply these to raw concentration values.

  • Consider relative vs. absolute quantification: For comparative studies, consistent matrix use may be more important than absolute quantification.

  • Address sample dilution effects: Test samples at multiple dilutions to identify potential matrix interference, as linearity data shows dilution-dependent variations:

Sample DilutionSerum Recovery (%)EDTA Plasma Recovery (%)Heparin Plasma Recovery (%)
1:286-97%95-102%96-105%
1:488-95%86-97%93-101%
1:881-97%88-95%90-98%
1:1682-96%92-101%87-98%
  • Validate findings across methodologies: Confirm key findings using orthogonal detection methods such as Western blotting or immunohistochemistry in addition to ELISA.

What analytical approaches can distinguish between AGTR1 expression changes due to experimental intervention versus natural variation?

Distinguishing experimental effects from natural variation in AGTR1 expression requires robust analytical approaches:

For example, in IGF intervention studies, researchers observed an 88% increase in AGTR1 expression with IGF2 treatment (p=0.03) . To validate such findings, researchers should:

  • Confirm consistency across multiple experimental cohorts

  • Test for dose-dependency effects

  • Validate with multiple detection methods

  • Assess temporal dynamics through time-course studies

How can researchers effectively integrate AGTR1 expression data with functional outcomes in guinea pig models?

Effective integration of AGTR1 expression data with functional outcomes requires a multi-level analytical approach:

  • Correlation analysis:

    • Calculate Pearson or Spearman correlation coefficients between AGTR1 expression levels and functional parameters

    • Generate scatter plots with regression lines to visualize relationships

    • Consider non-linear relationships using appropriate regression models

  • Pathway analysis:

    • Examine concurrent changes in related molecules (e.g., angiotensinogen, renin)

    • Assess downstream signaling molecules like PI3K/Akt and Ras/MAPK pathway components

    • Consider interaction effects with other systems (e.g., insulin-like growth factors)

  • Multi-parametric integration:

    • Apply principal component analysis or factor analysis to identify patterns across multiple variables

    • Utilize hierarchical clustering to identify subgroups with similar expression and functional profiles

    • Consider machine learning approaches for complex pattern recognition

  • Functional validation:

    • Employ receptor antagonists to confirm causality between AGTR1 activation and observed outcomes

    • Use genetic approaches (if available) such as AGTR1 knockdown to validate functional relationships

    • Apply pharmacological interventions at different dosages to establish dose-response relationships

  • Temporal considerations:

    • Track both expression and functional changes over time to establish causality

    • Consider delayed effects, as seen in the IGF2 studies where early intervention had sustained effects at day 62

    • Implement time-series analysis to identify temporal patterns and lag effects

When applying these approaches, researchers should be mindful that the relationship between AGTR1 expression and function may vary across tissues and physiological states, as demonstrated by the tissue-specific effects observed in placental studies .

What are the most promising applications of recombinant guinea pig AGTR1 in disease model development?

Recombinant guinea pig AGTR1 holds significant potential for advancing disease model development in several key areas:

  • Cardiovascular disease models: Given AGTR1's crucial role in blood pressure regulation and cardiovascular health, recombinant AGTR1 can serve as a tool for developing more refined guinea pig models of hypertension, heart failure, and vascular dysfunction .

  • Pregnancy complication models: The interaction between AGTR1 and growth factors in placental development suggests applications in modeling pregnancy disorders like preeclampsia and intrauterine growth restriction. The documented effects of IGFs on AGTR1 expression provide a foundation for these models .

  • Inflammatory and immune disorders: The potential connection between AGTR1 and allergic responses in guinea pig models of concurrent allergic rhinitis and asthma opens avenues for investigating AGTR1's role in inflammatory conditions .

  • Cancer research applications: The variable expression of AGTR1 in various human cancers suggests potential applications in oncology research. Recombinant guinea pig AGTR1 could facilitate studies on tumor growth and angiogenesis mechanisms in relevant guinea pig models .

  • Drug development platforms: Recombinant AGTR1 can enable high-throughput screening of novel compounds targeting the renin-angiotensin system with potential therapeutic applications across multiple disease states.

How might advanced recombinant DNA techniques enhance the study of AGTR1 in guinea pig models?

Advanced recombinant DNA techniques offer several promising approaches to enhance AGTR1 research in guinea pig models:

  • CRISPR/Cas9 genome editing:

    • Generate guinea pig models with specific AGTR1 mutations to study receptor variants

    • Create conditional knockout models to study tissue-specific AGTR1 functions

    • Introduce reporter genes linked to AGTR1 expression for real-time monitoring

  • AAV-mediated gene delivery:

    • Deliver modified AGTR1 variants to specific tissues in adult guinea pigs

    • Overexpress or suppress AGTR1 in targeted organs to study localized effects

    • Introduce human AGTR1 variants in guinea pig models to study human-specific functions

  • Single-cell transcriptomics:

    • Profile AGTR1 expression at single-cell resolution across tissues

    • Identify cell populations with differential AGTR1 expression and response patterns

    • Map AGTR1-expressing cells in complex tissues like placenta or vascular beds

  • Receptor chimeras and biosensors:

    • Develop fluorescent AGTR1 fusion proteins to visualize receptor trafficking

    • Create AGTR1-based biosensors to monitor angiotensin II levels in vivo

    • Design receptor chimeras to study domain-specific functions

  • Phage display refinements:

    • Enhance existing phage display techniques for generating highly specific anti-AGTR1 antibodies

    • Develop antibody fragments targeting specific AGTR1 epitopes or conformational states

    • Create bispecific antibodies targeting AGTR1 and related signaling molecules

Each of these approaches offers unique advantages for addressing specific aspects of AGTR1 biology in guinea pig models, potentially accelerating translational research in cardiovascular, reproductive, and inflammatory disorders.

How can researchers address inconsistent detection of AGTR1 in guinea pig samples?

Inconsistent detection of AGTR1 in guinea pig samples can be addressed through systematic troubleshooting of several potential factors:

  • Sample preparation optimization:

    • Ensure consistent tissue homogenization methods

    • Standardize protein extraction buffers (consider detergent composition for membrane protein extraction)

    • Include protease inhibitors to prevent AGTR1 degradation

    • Minimize freeze-thaw cycles of samples

  • Antibody selection and validation:

    • Validate antibody specificity using positive controls (Hela, Raji, or MCF-7 whole cell lysates)

    • Test multiple antibody clones to identify optimal performance

    • Consider using recombinant monoclonal antibodies for greater consistency

    • Verify the expected 42 kDa band size in Western blot applications

  • Assay optimization:

    • Determine optimal sample dilutions within the linear range (1:2 to 1:16)

    • Adjust incubation times and temperatures

    • Optimize washing procedures to reduce background

    • Consider alternative detection methods if ELISA yields inconsistent results

  • Reference standards:

    • Use consistent lots of recombinant guinea pig AGTR1 standards

    • Prepare fresh standard curves for each experiment

    • Consider preparing a large batch of internal reference standard to use across experiments

  • Biological variability management:

    • Control for age, sex, and physiological state of guinea pigs

    • Standardize housing and dietary conditions

    • Consider diurnal variations in AGTR1 expression

    • Account for potential estrous cycle effects in female animals

By systematically addressing these factors, researchers can significantly improve the consistency of AGTR1 detection in guinea pig samples and enhance experimental reproducibility.

What strategies can improve specificity when detecting AGTR1 in complex tissue samples?

Improving specificity for AGTR1 detection in complex tissue samples requires multi-faceted approaches:

  • Pre-analytical sample processing:

    • Consider subcellular fractionation to enrich for membrane components where AGTR1 is located

    • Implement immunoprecipitation to concentrate AGTR1 before detection

    • Apply tissue-specific extraction protocols optimized for receptor proteins

  • Advanced antibody-based approaches:

    • Use a combination of antibodies targeting different AGTR1 epitopes

    • Implement sandwich ELISA with carefully selected capture and detection antibodies

    • Consider recombinant Fabs with guinea pig variable regions for enhanced specificity

  • Competitive binding assays:

    • Include specific AGTR1 antagonists as competitive controls

    • Perform peptide competition assays to confirm antibody specificity

    • Use angiotensin II binding assays as functional confirmation

  • Multiplexed detection strategies:

    • Combine AGTR1 detection with measurement of known interacting partners

    • Implement proximity ligation assays to detect AGTR1 only when in proximity to known binding partners

    • Use mass spectrometry-based approaches for peptide-specific detection

  • Validation across methodologies:

    • Confirm key findings with orthogonal methods (ELISA, Western blot, immunohistochemistry)

    • Include appropriate genetic models or pharmacological interventions as specificity controls

    • Consider receptor autoradiography with radiolabeled ligands for functional validation

By combining these approaches, researchers can achieve higher specificity in AGTR1 detection, particularly in complex tissues with multiple cell types and potential cross-reactive proteins.

How are novel recombinant antibody technologies advancing guinea pig AGTR1 research?

Novel recombinant antibody technologies are significantly advancing guinea pig AGTR1 research through several innovative approaches:

  • Phage display technology:

    • Enables generation of diverse antibody libraries (>5×10^6 members) displaying chimeric Fabs with guinea pig variable regions

    • Allows isolation of antibody fragments with high specificity for AGTR1 epitopes

    • Facilitates selection of antibodies that recognize native conformations of AGTR1 in cell membranes

  • Recombinant monoclonal antibodies:

    • Provide superior batch-to-batch consistency compared to polyclonal antibodies

    • Enable precise epitope targeting for distinct functional domains of AGTR1

    • Allow for engineering of specific properties such as affinity, stability, and detection tags

  • Antibody fragment technologies:

    • Development of smaller antibody formats (Fabs, scFvs) that maintain binding specificity

    • Enhanced tissue penetration for in vivo applications

    • Potential for targeting specific neural tissues expressing AGTR1

  • Humanized guinea pig antibodies:

    • Creation of chimeric antibodies with guinea pig variable regions and human constant regions

    • Reduced immunogenicity for therapeutic applications

    • Compatibility with human secondary detection systems

  • Receptor-specific targeting:

    • Development of antibodies that selectively bind to active versus inactive AGTR1 conformations

    • Creation of antibodies that modulate receptor activity for functional studies

    • Engineering of bispecific antibodies targeting AGTR1 and downstream signaling components

These technologies are transforming AGTR1 research by providing more precise tools for detection, localization, and functional manipulation of the receptor in guinea pig models of cardiovascular, reproductive, and inflammatory diseases.

What new methodological approaches are emerging for studying AGTR1 interactions with other signaling pathways?

Cutting-edge methodological approaches are emerging for studying AGTR1 interactions with other signaling pathways:

  • Proximity-based protein interaction assays:

    • Bioluminescence resonance energy transfer (BRET) for studying AGTR1 interactions with downstream effectors

    • Förster resonance energy transfer (FRET) to visualize AGTR1 dimerization and protein interactions

    • Split-luciferase complementation assays to detect protein-protein interactions in live cells

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize AGTR1 clustering and colocalization with signaling components

    • Single-molecule tracking to follow AGTR1 dynamics in real-time

    • Correlative light and electron microscopy to link AGTR1 function to subcellular structures

  • Multi-omics integration:

    • Phosphoproteomics to map AGTR1-induced signaling cascades

    • Interactomics using proximity labeling (BioID, APEX) to identify AGTR1 interaction partners

    • Integration of transcriptomic and proteomic data to understand pathway-level responses

  • Optogenetic and chemogenetic approaches:

    • Light-controlled AGTR1 variants to precisely activate receptor signaling

    • Chemically induced dimerization to control AGTR1 interactions with specific partners

    • Spatiotemporal control of AGTR1 signaling in specific cell populations

  • Computational modeling:

    • Molecular dynamics simulations of AGTR1 structural changes upon ligand binding

    • Systems biology models of AGTR1 signaling networks

    • Machine learning approaches to predict pathway crosstalk based on multi-omics data

These emerging methodologies are particularly relevant for understanding complex interactions, such as those between the renin-angiotensin system and insulin-like growth factors observed in placental development , or potential interactions with inflammatory pathways in allergic responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.