Recombinant Guizotia abyssinica ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Guizotia abyssinica ATP Synthase Subunit a (atpI)

Recombinant Guizotia abyssinica ATP synthase subunit a (atpI) refers to a chloroplast-encoded membrane protein (subunit a) of the F₀ sector of ATP synthase, recombinantly produced in E. coli for research purposes. This subunit plays a critical role in proton translocation across thylakoid membranes in plants, coupling proton motive force to ATP synthesis via coordinated rotation of the F₀F₁ complex . In Guizotia abyssinica (noug), atpI is encoded within a polycistronic operon containing genes for photosystem II (PSII) and photosystem I (PSI) components, emphasizing its integration with photosynthetic machinery .

Role in ATP Synthase Assembly and Function

Subunit a is a core component of the F₀ sector, forming part of the transmembrane proton channel. It interacts with subunits b, c, and the c-ring rotor to facilitate proton translocation . In Guizotia, atpI transcription is tightly regulated by the OPR protein MTHI1, which also governs the expression of atpH (subunit c) .

Polycistronic Transcription Unit

The atpI gene is co-transcribed with psbD (PSII D2 protein), psaA (PSI apoprotein), psbJ (PSII subunit), psaJ (PSI subunit), and rps12 (ribosomal protein S12) . Wild-type transcript profiles include:

  • Tetra-/tricistronic transcripts: psbJ-atpI-psaJ-rps12 (75% of atpI-containing mRNAs)

  • Dicistronic transcripts: atpI-psaJ-rps12

  • Monocistronic transcripts: atpI

Recombinant Production

The recombinant protein is expressed in E. coli using an in vitro system, yielding high-purity subunit a for structural, functional, and biochemical studies .

Impact of MTHI1 Mutation on atpI Expression

MTHI1 regulates atpI mRNA stability and translation. Mutants lacking MTHI1 exhibit:

ParameterWild TypeMTHI1 Mutant
atpI mRNA accumulation100%~60% reduction
Dicistronic transcripts~85%~15% remaining
Monocistronic transcripts~75%~25% remaining
AtpI protein synthesisNormalStrongly reduced
ATP synthase subunit accumulationNormalSeverely impaired

Data derived from RNA-seq and pulse-labeling experiments .

Mechanistic Implications

The reduced translation of atpI in mutants is not due to transcript degradation but impaired ribosome loading, as evidenced by polysome profiling. This highlights MTHI1’s role in post-transcriptional regulation, potentially stabilizing mRNA or recruiting translation factors .

Key Research Applications

ApplicationDetails
ATP Synthase AssemblyStudying subunit a interactions with c-ring and b-subunits in proton translocation .
Proton TranslocationAnalyzing the role of subunit a in generating torque for F₀F₁ rotation .
Chaperone FunctionInvestigating MTHI1’s regulatory role in atpI translation and complex biogenesis .

Comparative Insights from Other Organisms

In bacteria, subunit a homologs (e.g., AtpI in Bacillus) participate in c-ring oligomerization, though its absence does not fully abolish ATP synthase activity . By contrast, in Guizotia, atpI is indispensable for stable ATP synthase assembly, underscoring species-specific functional divergence .

Table 1: Effects of MTHI1 Mutation on atpI Expression

FeatureWild TypeMTHI1 Mutant
atpI mRNA levels100%~60%
Translation efficiencyHighSeverely impaired
ATP synthase subunitsNormalReduced accumulation

Source:

Table 2: Polycistronic Transcript Composition

Transcript TypeWild Type (%)MTHI1 Mutant (%)
Tetra-/tricistronic75%~60%
Dicistronic~85% (majority)~15%
Monocistronic~75%~25%

Source:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; GuabCp012; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Guizotia abyssinica (Niger) (Ramtilla)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLNGLYDLSGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATLAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGKILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What purification strategies are most effective for recombinant atpI proteins?

Purification of membrane proteins like atpI presents significant challenges due to their hydrophobic nature. Based on successful approaches used with other ATP synthase subunits, the following methodology is recommended:

  • Expression system selection:

    • Bacterial systems (E. coli) with specialized membrane protein expression strains

    • Cell-free expression systems that can incorporate membrane proteins directly into nanodiscs or liposomes

  • Affinity tag strategies:

    • C-terminal or N-terminal histidine tags (6-10 residues)

    • Placement of tags to avoid interference with membrane insertion or protein-protein interactions

  • Solubilization and purification:

    • Mild detergents (DDM, LMNG) to maintain native protein conformation

    • Two-step purification combining affinity chromatography with size exclusion

This approach mirrors successful strategies used for ATP synthase purification from organisms like Toxoplasma gondii, where both monomeric (~600 kDa) and dimeric (>1 MDa) forms were isolated through partial purification methods followed by mass spectrometry analysis .

How can researchers assess functional integration of recombinant atpI into ATP synthase complexes?

The following methodological approach can assess whether recombinant atpI properly integrates into functional ATP synthase complexes:

  • ATP synthase activity assays:

    • ATPase activity measurements using spectrophotometric methods

    • Membrane potential generation assays using fluorescent probes

    • Proton pumping assays in reconstituted liposomes

  • Complex stability analysis:

    • Blue Native PAGE to assess complex integrity

    • Size exclusion chromatography to confirm proper assembly

    • Thermal stability assays to evaluate complex robustness

  • Protein-protein interaction verification:

    • Cross-linking followed by mass spectrometry

    • Co-immunoprecipitation with antibodies against other ATP synthase subunits

    • FRET-based assays for proximity detection

This methodology follows approaches used in studies of bacterial AtpI, where deletion mutants showed reduced ATP synthase rotor stability and reduced membrane association of the F1 domain , providing quantifiable metrics for assessing proper integration.

What experimental approaches can resolve contradictory findings regarding atpI necessity?

Literature contains contradictory findings regarding the necessity of atpI for ATP synthase assembly. For example, some studies show AtpI is required for c-ring formation in hybrid Na+-coupled ATP synthases , while others demonstrate functional ATP synthase in atpI deletion strains . To address these contradictions, researchers should implement:

  • Systematic comparison across species and expression systems:

    • Parallel studies in native and heterologous expression systems

    • Controlled genetic backgrounds with complete deletion of endogenous atpI

    • Cross-species complementation assays

  • Quantitative assessment of ATP synthase assembly efficiency:

    • Absolute quantification of assembled complexes versus unassembled subunits

    • Time-course studies of assembly kinetics with and without atpI

    • Stress testing assembly under suboptimal conditions

  • Structure-function relationship mapping:

    • Domain swapping between AtpI proteins with different functional requirements

    • Site-directed mutagenesis of conserved residues

    • Cryo-EM structural analysis of assembly intermediates

This approach was partially validated in studies comparing the properties of ATP synthase from mutants with deletions in either atpI, atpZ, or both, which supported a chaperone-like role for alkaliphile AtpI in assembly of a stable, functional ATP synthase .

How does environmental stress influence atpI expression and function in Guizotia abyssinica?

Understanding the relationship between environmental stress and atpI function requires integrating data on stress responses with ATP synthase activity. For Guizotia abyssinica, a crop known to experience salt stress in agricultural settings, the following experimental design is recommended:

  • Transcriptomic and proteomic profiling:

    • RNA-seq under varying stress conditions

    • Quantitative proteomics to correlate transcript and protein levels

    • Polysome profiling to assess translational regulation

  • Physiological measurements correlated with atpI expression:

    • ATP synthase activity measurements under stress conditions

    • Chlorophyll fluorescence to assess photosynthetic efficiency

    • Growth parameters and biomass accumulation

  • Comparative analysis across cultivars with different stress tolerance:

    • Expression patterns in different Guizotia abyssinica cultivars under identical stress conditions

    • Correlation with physiological indicators of stress tolerance

    • Genetic association studies linking atpI variants to stress tolerance

This approach is supported by studies showing differential responses of Guizotia abyssinica cultivars to salt stress, where cultivars like 'IGP-76' showed less membrane damage and higher osmolyte accumulation than more susceptible cultivars like 'GA-10' . These physiological differences likely involve bioenergetic adaptations that could be linked to ATP synthase function.

What structural adaptations in atpI might contribute to stress tolerance in Guizotia abyssinica?

Exploring the relationship between atpI structural features and stress tolerance requires integrating structural biology with physiological studies. The following methodology is recommended:

  • Comparative structural analysis:

    • Prediction of transmembrane domains and protein topology

    • Identification of unique sequence motifs in stress-tolerant species

    • Molecular dynamics simulations to predict stability under different conditions

  • Structure-guided mutagenesis:

    • Generation of chimeric proteins between stress-tolerant and sensitive species

    • Site-directed mutagenesis of residues unique to stress-tolerant variants

    • Assessment of ATP synthase stability under stress conditions

  • In vivo validation:

    • Transformation of sensitive cultivars with atpI variants from tolerant cultivars

    • Physiological assessment under controlled stress conditions

    • Correlation of bioenergetic parameters with structural features

This approach is informed by studies showing differential responses of Guizotia abyssinica cultivars to salt stress, with measurements of seedling growth, chlorophyll content, malondialdehyde accumulation, and antioxidant enzyme activities demonstrating clear differences between tolerant and sensitive cultivars .

How does atpI interact with YidC family proteins during ATP synthase assembly?

Understanding the relationship between atpI and YidC family proteins is crucial for elucidating the complete assembly pathway of ATP synthase. The following experimental strategy addresses this question:

  • Interaction mapping:

    • Co-immunoprecipitation with tagged proteins

    • Split-protein complementation assays

    • FRET or BRET proximity assays

  • Assembly pathway delineation:

    • Time-course analysis of complex formation

    • Pulse-chase experiments following nascent protein integration

    • In vitro reconstitution with purified components

  • Comparative analysis across species:

    • Functional complementation assays

    • Expression pattern correlation

    • Genetic interaction mapping through synthetic lethal/sick screening

This approach is supported by findings that YidC family proteins (SpoIIIJ and YqjG) show functional overlap with AtpI in some systems, though with distinct contributions to growth under different pH conditions . While both spoIIIJ and yqjG could complement a YidC-depleted E. coli strain, atpI could not, suggesting specific functional differences in the assembly pathway .

What methodological approaches are most effective for studying atpI integration into thylakoid membranes?

Studying membrane protein integration into thylakoid membranes presents unique challenges. For chloroplastic atpI, the following methodological approach is recommended:

  • In vitro chloroplast import assays:

    • Radiolabeled protein import into isolated chloroplasts

    • Fractionation to confirm thylakoid membrane integration

    • Protease protection assays to determine topology

  • Visualization of membrane integration:

    • Fluorescently tagged atpI for confocal microscopy

    • Immunogold labeling for electron microscopy

    • FRAP analysis to assess membrane mobility

  • Reconstitution systems:

    • Liposome reconstitution with defined lipid composition

    • Nanodiscs for single-molecule studies

    • Planar lipid bilayers for electrophysiological measurements

These methods allow researchers to determine not only if atpI integrates into thylakoid membranes but also the kinetics, requirements, and topological orientation of the integration process, critical information for understanding its role in ATP synthase assembly in chloroplasts.

What are the technical limitations in structural studies of recombinant Guizotia abyssinica atpI?

Structural studies of membrane proteins like atpI face several technical challenges:

  • Expression and purification barriers:

    • Low expression levels in heterologous systems

    • Difficulty maintaining native conformation during purification

    • Aggregation tendency due to hydrophobic surfaces

  • Structural determination challenges:

    • Difficulty growing well-diffracting crystals for X-ray crystallography

    • Size limitations for NMR studies

    • Sample heterogeneity for cryo-EM

  • Methodological solutions:

    • Fusion proteins to enhance expression and solubility

    • Nanobody-assisted crystallization

    • Lipid cubic phase crystallization

    • Advanced cryo-EM techniques for smaller membrane proteins

Progress has been made in structural studies of ATP synthase components, as demonstrated by successful identification of key F0 subunits (a, b, and d) from conserved structural features despite extreme sequence diversification in organisms like Toxoplasma gondii .

How can systems biology approaches integrate atpI function into broader models of chloroplast bioenergetics?

Integrating atpI function into systems-level understanding requires multidisciplinary approaches:

  • Multi-omics integration:

    • Correlation of transcriptomics, proteomics, and metabolomics data

    • Flux balance analysis incorporating ATP synthase activity

    • Regulatory network modeling including stress response pathways

  • Predictive modeling approaches:

    • Mathematical modeling of ATP synthase assembly kinetics

    • Machine learning to predict functional outcomes from sequence data

    • Simulation of energy coupling under varying environmental conditions

  • Experimental validation strategies:

    • Targeted metabolic engineering based on model predictions

    • CRISPR-Cas9 genome editing for precise manipulation

    • High-throughput phenotyping under varying conditions

This systems approach enables researchers to understand how atpI impacts not just ATP synthase assembly but chloroplast bioenergetics as a whole, providing insight into how plants like Guizotia abyssinica maintain energy homeostasis under environmental stresses .

How has atpI evolved across photosynthetic organisms, and what does this reveal about functional constraints?

Understanding the evolutionary trajectory of atpI provides insights into its functional importance and adaptation:

  • Phylogenetic analysis methodology:

    • Maximum likelihood and Bayesian approaches for tree construction

    • Tests for selection (dN/dS ratios) to identify conserved domains

    • Ancestral sequence reconstruction to track evolutionary changes

  • Structure-function correlation across lineages:

    • Mapping conservation patterns onto predicted structures

    • Identifying co-evolving residues that maintain function

    • Correlating sequence changes with environmental adaptations

  • Horizontal gene transfer assessment:

    • Reconciliation of gene and species trees

    • Analysis of genomic context conservation

    • Detection of anomalous base composition or codon usage

This evolutionary perspective is important given the observed functional divergence in proteins like AtpI across species, where despite extreme sequence diversification, key structural features can be conserved, as observed in other ATP synthase components .

What methodological approaches can resolve the functional relationship between atpI and other assembly factors?

Elucidating the relationship between atpI and other assembly factors requires integrated approaches:

  • Protein interaction network mapping:

    • Affinity purification-mass spectrometry to identify interaction partners

    • Yeast two-hybrid or split-ubiquitin assays for direct interactions

    • Protein correlation profiling across fractionation gradients

  • Temporal assembly pathway delineation:

    • Time-resolved cross-linking mass spectrometry

    • Pulse-chase labeling combined with sequential immunoprecipitation

    • In vitro reconstitution with ordered addition of components

  • Genetic interaction characterization:

    • Double mutant analysis for synthetic phenotypes

    • Suppressor screens to identify functional relationships

    • Conditional depletion systems to control assembly factor levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.