Recombinant Guizotia abyssinica Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; GuabCp033; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Guizotia abyssinica (Niger) (Ramtilla)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLLYLASIVFLPWWISLLFQKSLESWVTNWWNTRQSETFLNDIEEKSILEKF IELEELLFLEEMIKEYSETHLQNLRIGIHKETIQLIKIHNEGRIHTILHFSTNIICFIIL SGYSIFGNKELVILNSWAQEFLYNLSDTIKAFSLLLLTDLCIGFHSPHGWELMIGFVYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the Guizotia abyssinica cemA protein and where is it localized?

The cemA (chloroplast envelope membrane protein) from Guizotia abyssinica (Niger plant) is encoded by the chloroplast genome. Despite its name suggesting envelope localization, current research indicates it is primarily located in the inner envelope membrane of chloroplasts . The protein is part of the chloroplast genome, which has been fully sequenced using Illumina technology complemented with traditional Sanger sequencing . While earlier assumptions suggested cemA encoded a cytochrome in the chloroplast envelope, recent spectrophotometric analyses have raised doubts about this classification as no cytochrome signals were detected in purified envelope preparations .

What expression systems are available for producing recombinant G. abyssinica cemA?

Multiple expression systems have been developed for the production of recombinant G. abyssinica cemA protein:

Expression SystemProduct CodeSpecial Features
E. coliCSB-EP458489GHI1Standard expression
E. coliCSB-EP458489GHI1-BAvi-tag Biotinylated
YeastCSB-YP458489GHI1Eukaryotic expression
BaculovirusCSB-BP458489GHI1Insect cell expression
Mammalian cellCSB-MP458489GHI1Mammalian expression

The selection of an appropriate expression system depends on research objectives, particularly regarding post-translational modifications and protein folding requirements .

What is the genetic and evolutionary context of cemA in G. abyssinica?

G. abyssinica (niger) is a diploid plant with 2n=30 chromosomes . It belongs to the family Asteraceae and is closely related to G. scabra subsp. schimperi based on cytological and genetic evidence . The chloroplast genome, which contains the cemA gene, shows conservation patterns typical of the Heliantheae tribe within Compositae. Analysis of duplicated genes in the G. abyssinica EST library indicates two paleopolyploidization events in its evolutionary history . The chloroplast genome has been fully sequenced without evidence of large rearrangements compared to related species .

What are the recommended methods for purifying chloroplast envelope membranes to study cemA?

For optimal purification of chloroplast envelope membranes containing cemA protein, follow this established protocol:

  • Isolate intact chloroplasts from plant leaves (e.g., spinach or G. abyssinica) using Percoll gradient centrifugation

  • Lyse chloroplasts in hypotonic buffer (10 mM MOPS-NaOH, pH 7.8)

  • Separate envelope membranes from thylakoids and stroma through centrifugation on a step-sucrose gradient

  • Store purified envelope membranes at high concentration (40-50 mg protein/ml) for analysis or flash-freeze in liquid nitrogen for long-term storage

Quality control should confirm the absence of contamination from thylakoids, mitochondria, or other cellular membranes through marker protein analysis . For cemA specifically, immunoblot analysis with antibodies against envelope marker proteins (like OEP24) can verify proper fractionation .

How should researchers approach the recombinant expression and purification of cemA protein?

For optimal expression and purification of recombinant cemA:

  • Select an appropriate expression system based on research needs (bacterial systems for structural studies; eukaryotic systems for functional studies)

  • For E. coli expression:

    • Use vectors containing appropriate tags (His, GST, or Avi-tag) for purification

    • Express at lower temperatures (16-20°C) to improve protein folding

    • Purify using affinity chromatography followed by size exclusion chromatography

  • For the biotinylated version, use the E. coli biotin ligase (BirA) system that specifically attaches biotin to the 15 amino acid AviTag peptide through amide linkage

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol for stability

Final purity should exceed 85% as confirmed by SDS-PAGE analysis .

What role might cemA play in chloroplast membrane redox chains and electron transport?

EPR (Electron Paramagnetic Resonance) studies of chloroplast envelope membranes have identified several redox-active components, including iron-sulfur proteins, semiquinones, and flavins . While cemA was initially proposed to encode a cytochrome, spectroscopic analyses have challenged this assignment as no cytochrome signals were detected in envelope preparations . Research suggests that cemA might instead be involved in other aspects of electron transport or membrane integrity.

For investigating potential redox functions of cemA:

  • Perform comparative EPR spectroscopy between wild-type and cemA-deficient chloroplasts

  • Analyze potential interactions with known redox components using:

    • Affinity purification with inactive proteases as baits (similar to FTSH11 studies)

    • Reduction with chemical agents (dithionite, 5-deazaflavin/oxalate)

    • Treatment with physiological redox mediators (NADH, NADPH, oxygen)

These approaches can elucidate whether cemA participates in envelope electron transport chains or has other membrane-related functions.

What protein-protein interactions does cemA participate in within the chloroplast envelope?

To investigate cemA protein interactions:

  • Use affinity purification methods with tagged versions of cemA (as done with FTSH11) :

    • Express epitope-tagged cemA (HA-tag or similar) under native promoter in cemA-deficient background

    • Perform co-immunoprecipitation followed by mass spectrometry analysis

  • Apply proximity-dependent labeling approaches:

    • Fuse cemA with enzymes like BioID or TurboID

    • Identify proteins in close proximity through biotinylation and streptavidin pulldown

  • Analyze potential interactions with:

    • Envelope proteases (like FTSH11)

    • Import machinery components

    • Other envelope proteins involved in metabolite transport or lipid biosynthesis

Research on other envelope proteins suggests that cemA might interact with stromal chaperonins like CPN60, similar to interactions observed with FTSH11 .

How can multi-omics approaches advance our understanding of cemA function?

Integrating multiple omics approaches can provide comprehensive insights into cemA function:

  • Transcriptomics:

    • RNA-seq analysis comparing wild-type and cemA mutants under different conditions

    • Investigation of co-expression networks to identify functionally related genes

  • Proteomics:

    • Quantitative proteomics to identify proteins affected by cemA mutation

    • Similar to studies with FTSH11, where comparative proteomic analysis revealed upregulated envelope proteins in knockout plants

  • Metabolomics:

    • Analysis of changes in lipid composition and metabolite profiles

    • Focus on compounds transported across the envelope membrane

  • Integration of datasets using systems biology approaches to develop predictive models of cemA function

What is the potential role of cemA in plant adaptation to environmental conditions?

G. abyssinica (niger) exhibits notable adaptability and medicinal properties that may relate to chloroplast function:

  • The plant shows significant antioxidant capacity in multiple assays, including DPPH scavenging and reducing power

  • Various G. abyssinica extracts demonstrate antimicrobial, antifungal, and antidiabetic properties

  • The plant's ability to grow in diverse conditions suggests robust stress response mechanisms

To investigate cemA's potential role in these adaptations:

  • Compare cemA sequence and expression between G. abyssinica ecotypes from different environmental conditions

  • Analyze cemA expression under various stresses (drought, temperature, light)

  • Assess the impact of cemA mutations on plant performance under stress conditions

  • Examine cemA-dependent changes in antioxidant capacity and metabolic profiles

How can structural biology techniques be applied to understand cemA function?

Advanced structural approaches can provide insights into cemA function:

  • Cryo-electron microscopy:

    • Analyze purified recombinant cemA in lipid nanodiscs

    • Investigate cemA in the context of intact envelope membranes

  • X-ray crystallography:

    • Crystallize purified, detergent-solubilized cemA protein

    • Identify structural domains and potential binding sites

  • In silico structural analysis:

    • Apply AlphaFold or similar tools to predict cemA structure

    • Perform molecular dynamics simulations in membrane environments

  • Integration with functional data:

    • Correlate structural features with biochemical activities

    • Design targeted mutations based on structural predictions to test functional hypotheses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.