Recombinant Guizotia abyssinica NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Biological Role in Chloroplasts

This subunit is integral to the chloroplastic NDH complex, which facilitates cyclic electron flow (CEF) to optimize ATP/NADPH ratios during photosynthesis. Key functions include:

  • Electron Transfer: Catalyzes the reduction of plastoquinones using NADPH, contributing to proton gradient generation for ATP synthesis .

  • Complex Stability: Interacts with other NDH subunits (e.g., subunits 1, 2, 4L) to maintain structural integrity and enzymatic activity .

  • Stress Adaptation: May play a role in photoprotection under stress conditions, though direct evidence for this specific subunit remains limited .

Research Applications

While direct studies on this recombinant protein are sparse, its attributes make it valuable for:

  • Functional Studies: Investigating subunit interactions within the NDH complex.

  • Biochemical Assays: Elucidating quinone reduction kinetics and cofactor dependencies (e.g., FAD).

  • Structural Analyses: X-ray crystallography to map binding sites for NADPH or quinones.

Production and Purification

The recombinant protein is produced via bacterial expression systems and purified using affinity chromatography (His-tag). Critical parameters include:

  • Expression Host: E. coli ensures high yield and cost-effectiveness .

  • Purification: Nickel or cobalt affinity columns exploit the His tag for selective binding .

  • Quality Control: Confirmatory Western blotting or mass spectrometry (not explicitly mentioned in sources but implied).

Comparative Insights from NQO1 Research

Though distinct from human NQO1 (cytosolic, FAD-dependent), shared enzymatic principles include:

  • Redox Cycling: Reduction of quinones to prevent oxidative damage .

  • Conformational Dynamics: Structural flexibility may influence substrate binding and catalytic efficiency .

FeatureGuizotia Subunit 3Human NQO1
LocalizationChloroplastCytosol
Primary FunctionPhotosynthetic electron flowDetoxification, ROS scavenging
Substrate PreferencePlastoquinonesUbiquinones, synthetic quinones

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; GuabCp026; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Guizotia abyssinica (Niger) (Ramtilla)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSLIPILVFFISGFLAPSSKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from NAD(P)H and plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure of NAD(P)H-quinone oxidoreductase relate to its function?

NAD(P)H-quinone oxidoreductase functions as a homodimer with two active sites formed from residues contributed by both polypeptide chains. The catalytic mechanism involves a tightly bound FAD cofactor that facilitates electron transfer during the reduction of quinones .

The enzyme employs a substituted enzyme mechanism where the FAD cofactor plays a critical role in the reduction process. The protein's mobility is crucial for proper function, as alterations in protein dynamics can affect catalytic efficiency. Research has shown that negative cooperativity in quinone oxidoreductases is likely mediated by alterations to the mobility of the protein structure .

What are the common alternative names and classification for this enzyme?

The enzyme is known by several alternative names in scientific literature:

Official NameAlternative NamesEnzyme Classification
NAD(P)H-quinone oxidoreductase subunit 3, chloroplasticNAD(P)H dehydrogenase subunit 3EC 1.6.5.-
NADH-plastoquinone oxidoreductase subunit 3
ndhC (gene name)

The enzyme belongs to the flavoprotein family that catalyzes the two-electron reduction of quinones and their derivatives .

What expression systems are optimal for producing recombinant G. abyssinica NAD(P)H-quinone oxidoreductase subunit 3?

Based on the available research data, recombinant G. abyssinica NAD(P)H-quinone oxidoreductase subunit 3 can be successfully expressed in bacterial expression systems, particularly E. coli. This approach is similar to the expression system used for the related NAD(P)H-quinone oxidoreductase subunit 4L from the same species .

For optimal expression:

  • Use a bacterial expression vector with a strong promoter (T7 or tac)

  • Include a histidine tag for purification purposes

  • Express in E. coli BL21(DE3) or similar strains optimized for recombinant protein expression

  • Induce expression with IPTG at concentrations between 0.1-1.0 mM

  • Grow cultures at 16-25°C post-induction to enhance soluble protein yield

The protein may require optimization of expression conditions due to its membrane-associated nature in its native environment .

What are the recommended storage conditions for maintaining enzyme stability?

To maintain optimal stability of recombinant NAD(P)H-quinone oxidoreductase subunit 3, the following storage conditions are recommended:

  • Store at -20°C for regular use, or -80°C for extended storage

  • Use a storage buffer containing Tris-based buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles, which can compromise protein activity

  • For working aliquots, store at 4°C for up to one week

  • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 20-50%

These storage recommendations are based on protocols developed for related recombinant proteins from Guizotia abyssinica and should help maintain the structural integrity and enzymatic activity of the protein.

How can the enzymatic activity of NAD(P)H-quinone oxidoreductase be measured?

Enzymatic activity of NAD(P)H-quinone oxidoreductase can be measured through several spectrophotometric assays that track either substrate consumption or product formation:

  • NADH/NADPH Oxidation Assay: Monitor the decrease in absorbance at 340 nm as NAD(P)H is oxidized to NAD(P)+ during the reaction.

  • Dichlorophenolindophenol (DCPIP) Reduction Assay: Measure the decrease in absorbance at 600 nm as the electron acceptor DCPIP is reduced.

  • Cytochrome c Reduction Assay: Track the increase in absorbance at 550 nm as cytochrome c is reduced in the presence of the enzyme and NAD(P)H.

For inhibition studies, compounds like dicoumarol can be used as they act as competitive inhibitors of the enzyme . When designing these assays, it's important to consider the potential confounding effects of other cellular reductases if working with crude extracts rather than purified enzyme.

What methods are effective for studying protein-protein interactions involving this enzyme?

Several methods can be employed to study protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 3:

  • Co-immunoprecipitation (Co-IP): Use antibodies against the protein of interest to precipitate it along with any interacting partners from cell lysates.

  • Yeast Two-Hybrid (Y2H): Express the enzyme as a fusion with a DNA-binding domain and potential interacting partners as fusions with an activation domain to detect interactions.

  • Bimolecular Fluorescence Complementation (BiFC): Split a fluorescent protein into two non-fluorescent fragments and fuse them to potentially interacting proteins.

  • Surface Plasmon Resonance (SPR): Immobilize the protein on a sensor chip and measure changes in refractive index when potential binding partners are flowed across the surface.

  • Cross-linking Mass Spectrometry: Use chemical cross-linking to covalently link interacting proteins, followed by mass spectrometry analysis to identify the partners.

These techniques can help elucidate how NAD(P)H-quinone oxidoreductase interacts with other components of the electron transport chain and regulatory proteins .

How can researchers differentiate between NAD(P)H-quinone oxidoreductase activity and other oxidoreductases in complex biological samples?

Differentiating NAD(P)H-quinone oxidoreductase activity from other oxidoreductases in complex biological samples requires specific experimental approaches:

  • Use of Specific Inhibitors: Employ dicoumarol, which specifically inhibits NQO1 activity without affecting most other oxidoreductases.

  • Substrate Specificity: Utilize substrates that are preferentially reduced by NAD(P)H-quinone oxidoreductase, such as menadione or other quinone derivatives.

  • Immunodepletion: Selectively remove the enzyme from samples using specific antibodies, then compare activity before and after depletion.

  • Genetic Approaches: Use cells/tissues from knockout models or employ siRNA to specifically reduce expression of the enzyme, then compare activity with wild-type samples.

  • pH Dependence: NAD(P)H-quinone oxidoreductase has a characteristic pH activity profile that differs from other oxidoreductases, which can be used for differentiation .

These approaches can be combined for more robust differentiation between various oxidoreductase activities in complex biological samples.

How does the G. abyssinica NAD(P)H-quinone oxidoreductase compare structurally and functionally to homologs in other plant species?

The NAD(P)H-quinone oxidoreductase from G. abyssinica shares structural and functional similarities with homologs from other plant species, but also exhibits unique features:

Comparative analysis shows that while the basic catalytic mechanism involving FAD-mediated electron transfer is conserved across species, there are notable differences in substrate specificity and regulatory mechanisms. Unlike some plant homologs, the G. abyssinica enzyme appears to be more specifically localized to chloroplasts, suggesting a specialized role in photosynthetic electron transport .

The amino acid sequence of G. abyssinica NAD(P)H-quinone oxidoreductase subunit 3 suggests the presence of transmembrane domains characteristic of membrane-bound oxidoreductases. This structural feature is consistent with its role in electron transport chains spanning the thylakoid membrane in chloroplasts .

Unlike the well-studied human NQO1 which has been implicated in cancer development, the plant homologs appear more specialized for roles in photosynthetic efficiency and oxidative stress management in chloroplasts .

What role does NAD(P)H-quinone oxidoreductase play in oxidative stress response in G. abyssinica?

NAD(P)H-quinone oxidoreductase plays a multifaceted role in oxidative stress response in G. abyssinica:

  • Quinone Detoxification: The enzyme catalyzes the complete two-electron reduction of potentially harmful quinones, preventing their participation in one-electron reduction pathways that generate reactive oxygen species (ROS) .

  • Maintenance of Antioxidants: Similar to mammalian homologs, the plant enzyme likely helps maintain endogenous lipid-soluble antioxidants in their reduced and active forms .

  • Direct ROS Scavenging: There is evidence that some NAD(P)H-quinone oxidoreductases can directly scavenge superoxide anion radicals, providing another layer of protection against oxidative damage .

  • Redox Homeostasis: By participating in electron transport chains, the enzyme helps maintain cellular redox balance, which is crucial for normal metabolic function under stress conditions .

The enzyme's expression may be induced under conditions of oxidative stress through regulatory mechanisms involving antioxidant response elements (AREs) in its promoter region, similar to what has been observed in mammalian systems .

How can structural modifications of NAD(P)H-quinone oxidoreductase affect its catalytic properties?

Structural modifications of NAD(P)H-quinone oxidoreductase can significantly impact its catalytic properties through several mechanisms:

  • Alterations in FAD Binding: Modifications that affect the binding of the FAD cofactor can dramatically impact catalytic activity. The FAD cofactor is essential for electron transfer during catalysis .

  • Changes in Protein Mobility: Evidence suggests that proper protein mobility is critical for normal function. Inappropriate mobility, whether increased or decreased, can result in dysfunction .

  • Dimer Interface Modifications: As the enzyme functions as a homodimer with active sites formed from both polypeptide chains, alterations at the dimer interface can affect subunit interactions and catalysis .

  • Substrate Binding Pocket Alterations: Modifications to amino acids lining the substrate binding pocket can alter substrate specificity or binding affinity, changing the enzyme's catalytic properties .

  • Post-translational Modifications: Phosphorylation, glycosylation, or other post-translational modifications may regulate enzyme activity or localization within the cell .

Understanding these structure-function relationships can guide protein engineering efforts to enhance enzyme stability or alter substrate specificity for biotechnological applications.

What techniques are most effective for studying the in vivo function of chloroplastic NAD(P)H-quinone oxidoreductase?

Several advanced techniques can be employed to study the in vivo function of chloroplastic NAD(P)H-quinone oxidoreductase:

  • CRISPR/Cas9 Gene Editing: Generate knockout or knockdown plant lines to study the physiological consequences of reduced enzyme activity.

  • Chloroplast Isolation and Subfractionation: Isolate intact chloroplasts and subfractionate them to study the localization and function of the enzyme within the organelle.

  • Chlorophyll Fluorescence Analysis: Monitor photosynthetic electron transport using PAM (Pulse Amplitude Modulation) fluorometry to assess how alterations in the enzyme affect photosynthetic efficiency.

  • Metabolomics Approaches: Use LC-MS or GC-MS to profile metabolite changes in plants with altered enzyme levels, providing insights into metabolic pathways affected.

  • Redox Proteomics: Identify proteins whose redox state changes in response to alterations in NAD(P)H-quinone oxidoreductase activity.

  • In vivo Imaging: Use fluorescently tagged versions of the enzyme to track its localization and dynamics within living plant cells.

  • Oxidative Stress Challenge Experiments: Expose plants with altered enzyme levels to various oxidative stressors and monitor physiological responses .

These techniques can provide complementary insights into the multifaceted roles of NAD(P)H-quinone oxidoreductase in plant physiology and stress responses.

How does NAD(P)H-quinone oxidoreductase activity correlate with antioxidant capacity in G. abyssinica?

Niger seed samples from different geographical regions exhibit varying antioxidant capacities as measured by DPPH scavenging assays. Samples from the East Gojjam region demonstrated the highest antioxidant activity with IC50 values of 132.79 ± 3.17 μg/mL when extracted with 80% aqueous methanol .

Sample SiteDPPH Scavenging IC50 value (μg/mL)
80% aqueous methanol
W/Wolega167.56 ± 3.76
E/Wolega190.50 ± 1.46
HG/Wolega174.45 ± 3.11
N/Gondar188.02 ± 3.75
E/Gojjam132.79 ± 3.17
Ascorbic acid2.49 ± 0.08

While direct measurements of NAD(P)H-quinone oxidoreductase activity in these samples are not available, the enzyme's known role in maintaining antioxidant capacity suggests it likely contributes to the observed antioxidant properties. These regional variations might reflect differences in enzyme expression or activity due to environmental factors or genetic diversity .

What is the relationship between NAD(P)H-quinone oxidoreductase and fatty acid composition in G. abyssinica?

G. abyssinica (Niger seed) is known for its high content of polyunsaturated fatty acids, which are susceptible to oxidation. The NAD(P)H-quinone oxidoreductase system may play a protective role in preventing lipid peroxidation of these fatty acids:

Fatty Acid TypeConcentration Range (mg/g)Primary Examples
Saturated Fatty Acids46.37 - 73.24Palmitic acid (24.8 - 37.1 mg/g), Stearic acid (18.3 - 30.3 mg/g)
Unsaturated Fatty Acids193.62 - 274.5Linoleic acid (179 - 234 mg/g), Vaccenic acid (13.1 - 38.3 mg/g)

The high concentration of unsaturated fatty acids, particularly linoleic acid, makes Niger seed oil nutritionally valuable but also potentially susceptible to oxidative damage. NAD(P)H-quinone oxidoreductase, through its role in maintaining cellular redox homeostasis and antioxidant capacity, may help protect these unsaturated fatty acids from oxidative degradation .

Seeds from the Amhara region (particularly North Gondar) showed both higher total fatty acid content (347.74 mg/g) and different antioxidant profiles compared to samples from other regions. This regional variation suggests potential differences in oxidative stress protection mechanisms, including possibly NAD(P)H-quinone oxidoreductase activity .

What are the potential applications of recombinant G. abyssinica NAD(P)H-quinone oxidoreductase in biotechnology?

Recombinant G. abyssinica NAD(P)H-quinone oxidoreductase offers several potential biotechnological applications:

  • Bioremediation: The enzyme's ability to detoxify quinones and related compounds could be harnessed for environmental applications, such as remediating polluted soils or water containing quinone-related industrial pollutants.

  • Biosensors: The enzyme could be incorporated into biosensors for detecting quinones, oxidative stress, or specific toxins in environmental or biological samples.

  • Antioxidant Supplements: Recombinant enzyme could potentially be developed as a novel antioxidant supplement for preventing oxidative damage in various contexts.

  • Plant Biotechnology: Transgenic expression in crop plants might enhance stress tolerance, potentially improving agricultural productivity under adverse conditions.

  • Pharmaceutical Applications: The enzyme's detoxifying properties could be exploited in drug development for conditions associated with oxidative stress, similar to applications being explored with mammalian NQO1 .

These applications would require further research to fully characterize the enzyme's properties and optimize its expression and stability for industrial or pharmaceutical use.

How might comparative studies between plant and mammalian NAD(P)H-quinone oxidoreductases inform cancer research?

Comparative studies between plant and mammalian NAD(P)H-quinone oxidoreductases could provide valuable insights for cancer research:

  • Structural Insights: The plant enzymes may have unique structural features that could inform the design of selective inhibitors or activators of human NQO1, which is often overexpressed in cancer cells and considered a potential drug target .

  • Substrate Specificity: Understanding differences in substrate recognition between plant and mammalian enzymes could help in developing cancer-specific prodrugs that are selectively activated by human NQO1 in tumor cells.

  • Regulatory Mechanisms: Comparing how plant and mammalian enzymes are regulated at the transcriptional and post-translational levels might reveal new approaches for modulating NQO1 activity in cancer contexts.

  • Evolution of Function: Studying the evolutionary relationships between plant and mammalian enzymes could identify conserved functional domains that are essential for activity versus species-specific adaptations.

  • p53 Stabilization: Human NQO1 stabilizes p53, a key tumor suppressor. Investigating whether plant homologs have similar protein-stabilizing functions could provide insights into this critical cancer-related mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.