Recombinant Guizotia abyssinica NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the estimated delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ndhE; GuabCp075; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Guizotia abyssinica (Niger) (Ramtilla)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSFVLYGLITSRNMVRALMCLELILNAVNLNFVTFSDFFDSRQLKGA IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH transfers electrons from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. The enzyme couples the redox reaction to proton translocation, conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does NAD(P)H-quinone oxidoreductase function within chloroplastic systems?

NAD(P)H-quinone oxidoreductase functions as part of the chloroplastic electron transport system, catalyzing the redox reactions between NAD(P)H and quinones. The enzyme requires either NADH or NADPH as an electron donor for its enzymatic activity . Unlike its cytosolic counterpart NQO1, the chloroplastic subunit 4L specifically participates in cyclic electron flow around photosystem I, which is crucial for:

  • Balancing the ATP/NADPH ratio produced during photosynthesis

  • Photoprotection during high light intensity exposure

  • Optimizing photosynthetic efficiency under varying environmental conditions

  • Contributing to the plant's response to oxidative stress

The enzyme catalyzes the reduction of plastoquinone, facilitating electron transport that ultimately contributes to the proton gradient across the thylakoid membrane, driving ATP synthesis.

What expression systems are most effective for recombinant production of NAD(P)H-quinone oxidoreductase subunit 4L?

The most effective expression system for recombinant NAD(P)H-quinone oxidoreductase subunit 4L from Guizotia abyssinica is Escherichia coli. Based on commercial production protocols, the full-length protein (1-101aa) can be effectively expressed in E. coli with an N-terminal His-tag fusion . This approach provides several advantages:

  • High yield of functional protein

  • Ease of purification using affinity chromatography

  • Relatively low cost and rapid production timeline

  • Well-established protocols for induction and harvest

When expressing this membrane protein, it's critical to optimize temperature and IPTG concentration during induction, as membrane proteins can form inclusion bodies at high expression levels. Lower temperatures (16-25°C) and reduced IPTG concentrations often improve soluble expression yields.

What are the recommended storage and handling procedures for maintaining activity of the recombinant protein?

For optimal stability and activity maintenance of recombinant NAD(P)H-quinone oxidoreductase subunit 4L, the following storage and handling procedures are recommended:

Storage ConditionRecommendationPurpose
Long-term storage-20°C/-80°C in aliquotsPrevents repeated freeze-thaw cycles
Storage bufferTris-based buffer, pH 8.0 with 6% trehalose or 50% glycerolStabilizes protein structure
Working aliquots4°C for up to one weekMaintains activity for ongoing experiments
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Optimal concentration for functional assays

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce enzyme activity . For reconstitution of lyophilized protein, brief centrifugation prior to opening is recommended to ensure all material is at the bottom of the container. Adding glycerol to a final concentration of 5-50% is advised for aliquots intended for long-term storage.

What are the optimal assay conditions for measuring NAD(P)H-quinone oxidoreductase activity?

The optimal assay conditions for measuring NAD(P)H-quinone oxidoreductase activity involve spectrophotometric monitoring of either NAD(P)H oxidation or quinone reduction. A standardized methodology includes:

  • Buffer system: 50 mM potassium phosphate buffer, pH 7.4

  • Temperature: 25-30°C (thermostated)

  • Substrate concentrations:

    • NAD(P)H: 50-200 μM

    • Quinone substrate (e.g., menadione): 10-50 μM

  • Detection method: Decrease in absorbance at 340 nm (NAD(P)H oxidation) or increase in absorbance at specific wavelengths for reduced quinones

Activity calculations should account for both enzymatic and non-enzymatic rates of NAD(P)H oxidation. The specific activity is typically expressed as nmol of NAD(P)H oxidized per minute per mg of protein under standard conditions.

How can researchers differentiate between direct and indirect effects on NAD(P)H-quinone oxidoreductase activity?

Differentiating between direct and indirect effects on NAD(P)H-quinone oxidoreductase activity requires a multi-faceted experimental approach:

  • In vitro assays with purified enzyme: Direct effects can be established by observing changes in enzyme kinetics (Km, Vmax) when the test compound is added to purified recombinant enzyme. Lineweaver-Burk or Eadie-Hofstee plots can identify competitive, non-competitive, or uncompetitive inhibition.

  • Cellular systems:

    • Measure enzyme activity in cell/tissue extracts before and after treatments

    • Quantify protein and mRNA levels to determine if changes in activity reflect altered expression

    • Use selective inhibitors to block specific pathways and identify indirect regulatory mechanisms

  • Controls to identify indirect effects:

    • Assess redox status changes that might affect NAD(P)H availability

    • Measure expression of transcription factors known to regulate oxidoreductase genes

    • Analyze post-translational modifications using mass spectrometry

  • Time-course experiments: Direct effects typically occur rapidly, while indirect effects involving gene expression or protein synthesis show delayed responses.

How does NAD(P)H-quinone oxidoreductase contribute to antioxidant defense in Guizotia abyssinica?

NAD(P)H-quinone oxidoreductase plays a crucial role in the antioxidant defense system of Guizotia abyssinica, particularly during environmental stress conditions. The enzyme's contribution includes:

The antioxidant response in Guizotia abyssinica appears to function effectively up to 300 mM NaCl over 48 hours, suggesting a substantial tolerance to salinity stress .

What experimental approaches can best evaluate NAD(P)H-quinone oxidoreductase's role during environmental stress?

To comprehensively evaluate NAD(P)H-quinone oxidoreductase's role during environmental stress, researchers should implement a multi-level experimental design:

  • Transcript analysis:

    • qRT-PCR to quantify ndhE gene expression changes under stress conditions

    • RNA-seq to identify co-regulated genes in stress response networks

  • Protein-level analysis:

    • Western blotting to measure protein abundance changes

    • Activity assays to determine functional changes in enzyme capacity

    • Immunolocalization to track potential subcellular redistribution

  • Physiological measurements:

    • Relative water content (RWC) and biomass changes under stress

    • Photosynthetic parameters (electron transport rate, quantum yield)

    • Correlation of enzyme activity with stress markers (H₂O₂, malondialdehyde)

  • Genetic approaches:

    • RNAi or CRISPR-based modification of ndhE expression

    • Complementation studies in model organisms

  • Metabolic impact:

    • Measure NAD(P)H/NAD(P)⁺ ratios under stress

    • Quantify downstream metabolites affected by altered electron flow

When studying salinity stress specifically, a concentration gradient approach (0-500 mM NaCl) with time-course measurements (0-72h) has proven effective for Guizotia abyssinica .

How does the sequence and function of NAD(P)H-quinone oxidoreductase subunit 4L vary across plant species?

The NAD(P)H-quinone oxidoreductase subunit 4L shows notable sequence conservation across plant species while maintaining species-specific variations that may correlate with environmental adaptations. A comprehensive analysis should consider:

  • Sequence alignment: Multiple sequence alignment reveals conserved functional domains versus variable regions that may confer species-specific properties.

  • Phylogenetic context: Within the genus Guizotia, molecular phylogenetic analyses using internal transcribed spacers (ITS) and chloroplast DNA sequences provide evolutionary context for understanding the development of this enzyme system .

  • Functional conservation: Despite sequence variations, the core catalytic function—quinone reduction using NAD(P)H as an electron donor—remains conserved across species.

  • Stress adaptation correlation: Variations in sequence might correlate with the plant's native environment and stress tolerance capabilities. For example, Guizotia abyssinica shows notable salinity tolerance up to 300 mM NaCl , which may be partially attributed to its NAD(P)H-quinone oxidoreductase system.

Researchers should approach comparative analysis by combining sequence data with functional assays to determine whether sequence variations translate to meaningful differences in enzyme efficiency, substrate specificity, or stress response capability.

How can the recombinant NAD(P)H-quinone oxidoreductase be utilized in biotechnology applications?

The recombinant NAD(P)H-quinone oxidoreductase subunit 4L from Guizotia abyssinica has several potential biotechnology applications based on its enzymatic properties and role in redox systems:

  • Bioremediation:

    • Detoxification of quinone-containing environmental pollutants

    • Development of enzyme-based biosensors for detecting quinone compounds in environmental samples

  • Agricultural applications:

    • Engineering enhanced stress tolerance in crops

    • Development of screening tools for identifying plants with improved oxidative stress resistance

  • Research tools:

    • Structure-function studies of chloroplastic electron transport

    • Comparative analysis of redox systems across plant species

  • Therapeutic research:

    • Studies on NAD(P)H-quinone oxidoreductase mechanisms can inform research on the human homolog NQO1, which has significant implications for cancer and chemoresistance

    • Model system for investigating electron transport inhibitors

When utilizing the recombinant protein for these applications, researchers should consider the optimal buffer conditions (Tris/PBS-based buffer, pH 8.0) and storage requirements (-20°C/-80°C with glycerol) to maintain enzyme activity and stability.

What are the methodological approaches for investigating interactions between NAD(P)H-quinone oxidoreductase and other proteins in the chloroplastic electron transport chain?

Investigating protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 4L requires specialized techniques appropriate for membrane-associated proteins:

  • Co-immunoprecipitation variants:

    • Chemical crosslinking followed by immunoprecipitation (to stabilize transient interactions)

    • Detergent optimization crucial for membrane protein solubilization without disrupting native interactions

    • Quantitative co-IP combined with mass spectrometry for interaction dynamics

  • Proximity-based labeling methods:

    • BioID or APEX2 fusion proteins to identify neighboring proteins in the membrane environment

    • Time-resolved proximity labeling to capture dynamic interaction changes

  • Förster resonance energy transfer (FRET):

    • FRET sensors designed with fluorescent protein tags on candidate interaction partners

    • Can detect interactions in native membrane environments in vivo

  • Reconstitution systems:

    • Liposome reconstitution of purified components

    • Measurement of electron transfer rates between reconstituted components

  • Split-reporter systems:

    • Split-GFP or split-luciferase complementation assays

    • Particularly useful for confirming hypothesized interactions in heterologous systems

For all these approaches, appropriate controls must include tests for interaction specificity and consideration of the membrane environment's impact on protein behavior.

How can researchers address inconsistent activity measurements when working with recombinant NAD(P)H-quinone oxidoreductase?

Inconsistent activity measurements of recombinant NAD(P)H-quinone oxidoreductase can stem from multiple factors. A systematic troubleshooting approach includes:

  • Protein quality assessment:

    • Verify protein purity (>90% by SDS-PAGE)

    • Check for proper folding using circular dichroism or fluorescence spectroscopy

    • Ensure complete reconstitution of lyophilized protein by allowing sufficient hydration time

  • Assay optimization:

    • Standardize enzyme concentration (typically 0.1-1.0 mg/mL)

    • Control temperature precisely during measurements

    • Establish consistent substrate preparation protocols (quinones often have limited solubility)

  • Buffer considerations:

    • Verify pH stability throughout the assay

    • Test for buffer component interference with detection methods

    • Ensure consistent ionic strength across experiments

  • Data analysis refinement:

    • Subtract non-enzymatic background rates

    • Use initial velocity measurements to avoid product inhibition effects

    • Apply appropriate enzyme kinetics models for data interpretation

  • Storage-related issues:

    • Prepare fresh working aliquots for each experiment series

    • Store at 4°C for no more than one week

    • Add stabilizers (glycerol 5-50%) to prevent activity loss during storage

Implementing a quality control system with standard reference samples can help track and normalize activity measurements across different experimental sessions.

What approaches can resolve solubility and stability challenges with the recombinant protein?

Addressing solubility and stability challenges with recombinant NAD(P)H-quinone oxidoreductase subunit 4L requires specialized approaches for membrane-associated proteins:

  • Solubility enhancement strategies:

    • Optimize detergent type and concentration (typically mild non-ionic detergents like DDM or LMNG)

    • Screen buffer compositions systematically (varying pH, ionic strength, additives)

    • Include stabilizing agents such as trehalose (6%) as used in commercial preparations

    • Consider fusion partners designed for membrane protein expression

  • Stability optimization:

    • Store in glycerol (recommended final concentration 50%)

    • Aliquot to minimize freeze-thaw cycles

    • Use antioxidants in storage buffers to prevent oxidative damage

    • Maintain constant pH (typically pH 8.0 as used in commercial preparations)

  • Reconstitution methods:

    • For lyophilized protein, ensure complete reconstitution with gentle mixing

    • Allow sufficient equilibration time after reconstitution before activity measurement

    • Centrifuge briefly before opening to collect all material at the bottom of the container

  • Handling during experiments:

    • Maintain samples on ice when not actively being used

    • Prepare fresh working dilutions for each experimental session

    • Consider the presence of metal ions that might affect stability

Implementation of these strategies should be monitored through activity assays and protein quantification to determine their effectiveness for this specific protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.