Recombinant Guizotia abyssinica Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The psbB gene encodes the CP47 protein, a chlorophyll-binding subunit integral to Photosystem II (PSII). CP47 anchors chlorophyll molecules and stabilizes the PSII reaction center, enabling efficient light-driven water oxidation . In Guizotia abyssinica, recombinant CP47 is expressed heterologously for biochemical and biophysical studies, aiding research into photosynthetic mechanisms and stress responses .

Research Applications

Recombinant CP47 is utilized in:

  • Photosystem Assembly Studies: Investigating interactions with PsbH, PsbL, and PsbT during PSII biogenesis .

  • Stress Response Analysis: Evaluating CP47 stability under high-light or oxidative stress .

  • Antibody Production: Serving as an antigen for antibodies used in chloroplast proteomics .

Challenges in Recombinant Production

  • Expression Stability: CP47’s hydrophobic nature complicates solubilization, necessitating optimized E. coli expression systems .

  • Post-Translational Modifications: Lack of chloroplast-specific chaperones in bacterial systems may limit native folding .

Comparative Analysis with Other Species

CP47 sequences and functions are highly conserved across plants and algae:

SpeciesUniProt IDKey Features
Guizotia abyssinicaB2LML9Recombinant His-tagged variant; used in antibody development
Spinacia oleraceaP04160Full-length E. coli-expressed protein; used in structural studies
Arabidopsis thalianaATCG00680Interacts with PAM68; essential for PSII stability

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis of recombinant CP47 to map chlorophyll-binding sites .

  • Genetic Engineering: Leveraging Guizotia abyssinica’s genetic diversity (as shown in RNA-Seq data ) to engineer stress-tolerant PSII variants.

  • Biotechnological Applications: Optimizing CP47 for synthetic photosynthesis systems or biohybrid solar cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
psbB; GuabCp048; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Guizotia abyssinica (Niger) (Ramtilla)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTTTNPGIWSYEGVAGAHIMFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPSWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE VWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPVTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of CP47 chlorophyll apoprotein (psbB) in Guizotia abyssinica?

CP47 is a core antenna chlorophyll binding subunit of Photosystem II that plays a crucial role in proper PSII function. The protein consists of 508 amino acid residues with a molecular weight of approximately 56.0 kD (as determined from nucleotide sequence analysis) . The amino acid sequence includes multiple transmembrane domains that anchor the protein within the thylakoid membrane.

Functionally, CP47 serves as a light-harvesting component that is only made when D1 has successfully assembled with D2. Its recruitment facilitates the binding of oxygen evolving enhancer (OEE) proteins . The protein contains multiple chlorophyll binding sites that participate in excitation energy transfer to the reaction center.

What are the optimal conditions for expression and purification of recombinant psbB from Guizotia abyssinica?

For successful expression and purification of recombinant Guizotia abyssinica psbB, researchers should consider:

Expression System Selection:

  • E. coli-based systems may require codon optimization due to the plant origin of the gene

  • Plant-based expression systems (tobacco, Arabidopsis) may provide better post-translational modifications

  • Yeast or insect cell systems can be alternatives for membrane protein expression

Purification Protocol:

  • Lyse cells in Tris-based buffer with appropriate detergents (typically DDM or β-OG)

  • Utilize affinity chromatography based on the tag used (as noted in product information, tag type may vary)

  • Consider size exclusion chromatography as a second purification step

  • Maintain glycerol (approximately 50%) in all buffers to maintain protein stability

Storage Conditions:
Store at -20°C for regular use, or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What experimental approaches are recommended for studying protein-protein interactions involving CP47 in photosystem II complexes?

Several methodological approaches can be employed to study CP47 interactions within PSII:

Co-immunoprecipitation (Co-IP):

  • Use antibodies against CP47 to pull down interaction partners

  • Analyze complexes using mass spectrometry to identify novel binding partners

  • Verify with reciprocal Co-IP experiments

Crosslinking Mass Spectrometry:

  • Apply chemical crosslinkers to stabilize transient interactions

  • Digest crosslinked complexes and analyze by tandem mass spectrometry

  • Map interaction sites at the amino acid resolution level

Yeast Two-Hybrid or Split-GFP Assays:
While challenging for membrane proteins, modified versions of these techniques can help identify specific interaction domains between CP47 and other PSII subunits.

Förster Resonance Energy Transfer (FRET):
Particularly useful for studying CP47 interactions with chlorophyll molecules and neighboring proteins in the PSII complex.

Research has confirmed interactions between CP47 and several proteins including PAM68 , suggesting its role in PSII assembly and function extends beyond chlorophyll binding.

How can researchers investigate the role of CP47 in photosystem II assembly and stability?

Mutagenesis Approaches:

  • Generate site-directed mutations in conserved domains of the CP47 protein

  • Express mutant variants in suitable host systems (preferably photosynthetic organisms)

  • Assess PSII assembly efficiency through BN-PAGE and immunoblotting

  • Measure oxygen evolution and electron transport rates to evaluate functional impact

Pulse-Chase Experiments:

  • Label newly synthesized proteins with radioisotopes or non-radioactive labels

  • Track PSII assembly intermediates over time using immunoprecipitation

  • Determine how CP47 incorporation affects subsequent assembly steps

Cryo-EM Structural Analysis:

  • Purify PSII complexes at different assembly stages

  • Use cryo-electron microscopy to resolve structural intermediates

  • Map conformational changes associated with CP47 incorporation

Research has established that CP47 is made only when D1 has successfully assembled with D2, and its recruitment facilitates the binding of oxygen evolving enhancer (OEE) proteins . This sequential assembly pattern provides a framework for investigating PSII biogenesis.

What methodological considerations are important when designing experiments to study CP47's role in excitation energy transfer?

Spectroscopic Techniques:

  • Time-resolved fluorescence spectroscopy to track energy transfer kinetics

  • Circular dichroism to monitor chlorophyll organization within the protein

  • Transient absorption spectroscopy to measure ultrafast energy transfer events

Sample Preparation Considerations:

  • Maintain native-like lipid environment or reconstitute in nanodiscs/liposomes

  • Control detergent concentration to prevent protein denaturation

  • Consider temperature effects on energy transfer measurements (4-25°C optimal range)

Data Analysis Approaches:

  • Global analysis of time-resolved data using compartmental models

  • Target analysis to resolve specific energy transfer pathways

  • Correlation with structural data from crystallography or cryo-EM

CP47 serves as a core antenna chlorophyll binding subunit of PSII , making it critical for efficient excitation energy transfer to the reaction center. When designing experiments, researchers should consider the orientation of chlorophyll molecules within the protein matrix, as this dictates energy transfer pathways.

How do researchers approach comparative genomic studies of psbB across Guizotia species?

Methodological Framework for Comparative Genomics:

  • Sample Collection and DNA Extraction:

    • Collect diverse Guizotia species, focusing on G. abyssinica, G. scabra subsp. schimperi, G. scabra subsp. scabra, and G. villosa

    • Extract high-quality DNA from leaf tissue using CTAB or commercial plant DNA extraction kits

  • Sequencing Approaches:

    • Target amplification and sequencing of psbB gene using conserved primers

    • Whole chloroplast genome sequencing for comprehensive analysis

    • RNA-Seq to examine expression patterns across species

  • Comparative Sequence Analysis:

    • Multiple sequence alignment of psbB sequences

    • Phylogenetic tree construction using maximum likelihood or Bayesian methods

    • Selection pressure analysis using dN/dS ratios

  • Integration with Cytogenetic Data:

    • Consider chromosomal context, as all Guizotia species have 2n=30 chromosomes with similar karyotypes

    • Analyze synteny of chloroplast regions containing psbB

The close relationship between Guizotia species provides an excellent model for studying chloroplast gene evolution. Interspecific crosses have demonstrated that G. abyssinica and G. scabra subsp. schimperi form hybrids with 15 bivalents in 95% of pollen mother cells , suggesting close evolutionary proximity that could extend to chloroplast genes like psbB.

What can interspecific hybridization experiments reveal about psbB conservation and function across Guizotia species?

Methodological Approach to Interspecific Studies:

  • Crossing Experiments:

    • Perform controlled crosses between G. abyssinica and related species

    • Note that hybrid seed set is greater when G. abyssinica is used as male parent

    • Generate F1 hybrids for genetic and functional analysis

  • Cytological Analysis:

    • Examine chromosome pairing during meiosis

    • Analyze pollen viability as indicator of genomic compatibility

    • Assess chloroplast inheritance patterns

  • Functional Analysis of Hybrid Photosystems:

    • Isolate thylakoid membranes from hybrid plants

    • Compare PSII activity and assembly with parental species

    • Analyze CP47 incorporation efficiency in hybrid backgrounds

Pollen viability data from interspecific crosses shows variable compatibility: G. abyssinica × G. scabra subsp. schimperi (81.5%), G. abyssinica × G. scabra subsp. scabra (46.6%), and G. abyssinica × G. villosa (30.6%) . These patterns may correlate with conservation of chloroplast genes including psbB.

Cross CombinationBivalent FormationPollen Viability
G. abyssinica × G. scabra subsp. schimperi15 bivalents in 95% of cells81.5%
G. abyssinica × G. scabra subsp. scabra15 bivalents in 69% of cells46.6%
G. abyssinica × G. villosa15 bivalents in 89% of cells30.6%
G. scabra subsp. scabra × G. villosa15 bivalents in 89% of cells49.3%

Table 1: Cytological characteristics of interspecific hybrids involving Guizotia species

What are common challenges in expressing and purifying functional recombinant psbB, and how can they be overcome?

Challenge 1: Membrane Protein Solubility

  • Solution: Screen multiple detergents (DDM, β-OG, LDAO) for optimal solubilization

  • Methodology: Perform small-scale extractions with different detergents and analyze by BN-PAGE

  • Alternative: Consider using amphipols or nanodiscs for stabilization

Challenge 2: Proper Folding and Chlorophyll Integration

  • Solution: Co-express with chlorophyll biosynthesis genes

  • Methodology: Design expression vectors containing both psbB and key chlorophyll synthesis genes

  • Alternative: Isolate the apoprotein and reconstitute with purified chlorophylls in vitro

Challenge 3: Low Expression Yields

  • Solution: Optimize codon usage for expression host

  • Methodology: Use software tools to identify rare codons and modify accordingly

  • Alternative: Test different promoters and induction conditions

Challenge 4: Protein Instability During Purification

  • Solution: Include 50% glycerol in storage buffer

  • Methodology: Test stability with different buffer compositions and additives

  • Alternative: Consider rapid purification protocols to minimize exposure time

What analytical methods are most effective for verifying the structural integrity and functionality of recombinant psbB?

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy:

    • Measures secondary structure content (α-helices, β-sheets)

    • Protocol should include scanning from 190-260 nm for protein structure

    • Compare with reference spectra of native PSII complexes

  • Size Exclusion Chromatography (SEC):

    • Evaluates protein monodispersity and aggregation state

    • Can be coupled with multi-angle light scattering (SEC-MALS)

    • Should yield a single, symmetrical peak for properly folded protein

  • Limited Proteolysis:

    • Properly folded proteins show characteristic proteolytic patterns

    • Compare digest patterns of recombinant and native proteins by SDS-PAGE

    • Mass spectrometry of fragments can identify exposed regions

Functional Validation:

  • Chlorophyll Binding Assays:

    • Measure absorption and fluorescence spectra (peaks at 436 and 672 nm)

    • Calculate chlorophyll:protein ratios (expected ~20-25 Chl/CP47)

    • Thermal stability of chlorophyll-protein interactions

  • Reconstitution into Proteoliposomes:

    • Incorporate purified CP47 into liposomes with other PSII components

    • Measure energy transfer efficiency using time-resolved spectroscopy

    • Compare with native PSII membrane fragments

  • Interaction Assays:

    • Verify binding to known partners (D1, D2, PAM68)

    • Surface plasmon resonance or microscale thermophoresis for binding kinetics

    • Pull-down assays to confirm interacting partners

What statistical approaches are recommended for analyzing structural variations in psbB across experimental conditions?

Multivariate Analysis Methods:

  • Principal Component Analysis (PCA):

    • Reduce dimensionality of spectroscopic or structural data

    • Identify major sources of variation between experimental conditions

    • Protocol should include data normalization and scaling

    • Software recommendations: R (using packages like 'stats', 'FactoMineR') or Python (using 'scikit-learn')

  • Hierarchical Clustering:

    • Group similar protein structures or spectral profiles

    • Generate dendrograms to visualize relationships between variants

    • Use Euclidean distance or correlation-based distance metrics

    • Validate clustering stability through bootstrap analysis

  • Statistical Hypothesis Testing:

    • Compare structural parameters using appropriate statistical tests:

      • t-tests for comparing two conditions

      • ANOVA for multiple condition comparisons

      • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data

    • Apply multiple testing correction (Bonferroni, FDR) when performing numerous comparisons

Data Visualization Strategies:

  • Radar plots for comparing multiple structural parameters simultaneously

  • Violin plots to show distribution of measurements across conditions

  • Heat maps for visualizing changes across multiple experimental variables

How should researchers approach the interpretation of contradictory experimental results when studying psbB function?

Methodological Framework for Resolving Contradictions:

  • Systematic Evaluation of Experimental Conditions:

    • Create a comprehensive table of methodological differences between studies

    • Identify key variables: protein preparation, buffer composition, measurement conditions

    • Perform controlled experiments to test the impact of each variable

  • Meta-analysis Approach:

    • Collect all available data on the contradictory parameter

    • Standardize measurements to allow direct comparison

    • Perform weighted analysis based on methodological robustness

    • Test for publication bias using funnel plots or Egger's test

  • Reconciliation Strategies:

    • Develop integrative models that accommodate seemingly contradictory results

    • Consider context-dependency of protein function

    • Test whether contradictions result from different protein conformational states

  • Collaborative Resolution:

    • Initiate direct collaboration with labs reporting contradictory results

    • Design joint experiments with standardized protocols

    • Perform sample exchange to eliminate lab-specific variables

When contradictions arise in psbB functional studies, researchers should consider the protein's dynamic role in PSII assembly, where it interacts with multiple partners including PAM68 and facilitates binding of oxygen evolving enhancer proteins . The sequential nature of these interactions may explain apparent contradictions if experiments capture different assembly states.

How can CRISPR/Cas9 gene editing be applied to study psbB function in Guizotia abyssinica?

Methodological Framework for CRISPR/Cas9 Applications:

  • Guide RNA Design:

    • Target conserved functional domains in the psbB gene

    • Design multiple gRNAs using plant-optimized CRISPR design tools

    • Consider the chloroplast genome context (though note that standard CRISPR approaches target nuclear DNA)

  • Transformation Strategy:

    • Develop an Agrobacterium-mediated transformation protocol for Guizotia abyssinica

    • Consider biolistic transformation as an alternative

    • For chloroplast genome editing, specialized plastid transformation methods would be required

  • Phenotypic Analysis:

    • Measure photosynthetic parameters (oxygen evolution, chlorophyll fluorescence)

    • Analyze PSII assembly using BN-PAGE and immunoblotting

    • Perform comparative transcriptomics and proteomics

  • Potential Targeted Modifications:

    • Introduce point mutations in chlorophyll binding sites

    • Create truncations to study domain functions

    • Engineer tagged versions for in vivo tracking

The close relationship between Guizotia species offers opportunities for comparative functional genomics. Considering that G. abyssinica and G. scabra subsp. schimperi form highly fertile hybrids , researchers might leverage these relationships for cross-species functional complementation studies.

What are the most promising directions for applying structural knowledge of psbB to enhance photosynthetic efficiency?

Research Priorities for Applied psbB Research:

  • Structure-Guided Protein Engineering:

    • Modify chlorophyll binding sites to alter spectral properties

    • Engineer variants with enhanced stability under stress conditions

    • Design mutants with optimized energy transfer properties

  • Synthetic Biology Approaches:

    • Create chimeric proteins incorporating beneficial features from different species

    • Develop minimal PSII complexes with optimized architecture

    • Engineer regulatory elements for context-dependent expression

  • Integration with Crop Improvement:

    • Target psbB modifications that enhance photosynthetic efficiency under fluctuating light

    • Develop variants with improved repair mechanisms under high light stress

    • Create diagnostic tools to assess PSII function in field conditions

  • Methodological Requirements:

    • High-resolution structural models of CP47 in different functional states

    • Rapid screening systems for functional assessment

    • Field-testing protocols for photosynthetic efficiency

The fundamental role of CP47 as a core antenna chlorophyll binding subunit of PSII makes it a promising target for photosynthetic improvement. By understanding how this protein facilitates energy transfer and contributes to PSII stability, researchers can develop targeted approaches to enhance crop productivity under variable environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.