Recombinant Gymnodinium mikimotoi Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Gymnodinium mikimotoi Photosystem Q(B) protein

Photosystem Q(B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein, is a critical component of the photosynthetic machinery in the dinoflagellate Gymnodinium mikimotoi. This protein is encoded by the psbA gene and functions as a reaction center protein in Photosystem II (PSII), playing an essential role in the light-dependent reactions of photosynthesis. The recombinant version of this protein is produced through genetic engineering techniques to enable detailed study of its structure and function. Gymnodinium mikimotoi belongs to the diverse group of predominantly unicellular dinoflagellate algae, which are characterized by having distinct flagella and an amphiesma layer beneath the cell membrane .

The Photosystem Q(B) protein has garnered significant attention in the scientific community not only for its fundamental role in photosynthesis but also for its utility in evolutionary studies. The protein has been particularly valuable in understanding the complex evolutionary history of plastids in dinoflagellates, which represents one of the most intriguing stories in plastid evolution . Recent phylogenetic analyses using psbA gene sequences have contributed significantly to our understanding of the evolutionary relationships among different algal groups, including dinoflagellates, haptophytes, and rhodophytes.

Protein Identification and Classification

The Photosystem Q(B) protein from Gymnodinium mikimotoi is identified in the UniProt database with the accession number Q9TJ82. It is classified as an enzyme with the EC number 1.10.3.9, reflecting its role in electron transport processes. The protein belongs to a highly conserved family of photosynthetic reaction center proteins that are essential for light-harvesting and energy conversion in photosynthetic organisms .

Table 1: Key Identification Parameters of Recombinant Gymnodinium mikimotoi Photosystem Q(B) protein

ParameterInformation
Recommended NamePhotosystem Q(B) protein
Alternative Names32 kDa thylakoid membrane protein, Photosystem II protein D1
UniProt AccessionQ9TJ82
Enzyme ClassificationEC 1.10.3.9
Gene NamepsbA
Expression Region1-347
SpeciesGymnodinium mikimotoi (Dinoflagellate)

Biological Function in Photosynthesis

The Photosystem Q(B) protein, encoded by the psbA gene, serves as a crucial component of the Photosystem II reaction center. In photosynthetic organisms, this protein functions as the D1 protein, which plays a central role in the electron transport chain during the light-dependent reactions of photosynthesis. Specifically, the D1 protein binds cofactors necessary for the initial charge separation events that occur after light absorption.

The protein contains binding sites for various cofactors, including chlorophyll molecules, pheophytin, plastoquinone (the Q(B) site), and the manganese cluster that catalyzes water oxidation. The naming of the protein as "Photosystem Q(B) protein" specifically refers to its role in binding plastoquinone at the Q(B) site, where electron transfer occurs as part of the photosynthetic electron transport chain .

In dinoflagellates like Gymnodinium mikimotoi, this protein takes on additional significance due to the unique evolutionary history of plastids in these organisms. Dinoflagellates exhibit diverse photosynthetic pigment compositions, including those with peridinin and those with fucoxanthin as major carotenoids. Phylogenetic analyses using psbA gene sequences have contributed to understanding the evolutionary relationships between different photosynthetic dinoflagellate lineages .

Production and Purification

The recombinant version of Gymnodinium mikimotoi Photosystem Q(B) protein is produced through genetic engineering techniques that allow for the expression of the psbA gene in suitable host systems. While the specific expression system for this particular protein is not detailed in the available search results, similar photosystem proteins are commonly expressed in systems such as E. coli, as seen with the homologous protein from Synechococcus elongatus .

The recombinant protein production process typically involves cloning the psbA gene, transforming it into an expression host, inducing expression, and then purifying the resulting protein. The purification process likely involves affinity chromatography or other protein purification techniques that can yield highly pure protein preparations suitable for research applications.

Comparison with Synechococcus elongatus Photosystem Q(B) protein

The Photosystem Q(B) protein is highly conserved across different photosynthetic organisms, reflecting its essential role in photosynthesis. A comparison between the Gymnodinium mikimotoi Photosystem Q(B) protein and its homolog from the cyanobacterium Synechococcus elongatus reveals both similarities and differences that provide insights into evolutionary adaptations.

The Synechococcus elongatus Photosystem Q(B) protein 2 (psbA2) consists of 344 amino acids, slightly shorter than the 347 amino acids of the Gymnodinium mikimotoi protein. The Synechococcus protein is identified in the UniProt database with the accession number P0A447 .

Table 3: Comparison between Gymnodinium mikimotoi and Synechococcus elongatus Photosystem Q(B) proteins

FeatureGymnodinium mikimotoiSynechococcus elongatus
UniProt IDQ9TJ82P0A447
Amino Acid Length347344
Gene NamepsbApsbA2
Alternative Names32 kDa thylakoid membrane protein, Photosystem II protein D1Photosystem II protein D1 2, PSII D1 protein 2, Photosystem II Q(B) protein 2

Evolutionary Significance

The psbA gene, which encodes the Photosystem Q(B) protein, has been instrumental in phylogenetic studies aimed at understanding the complex evolutionary history of plastids in dinoflagellates and related algal groups. Combined phylogenetic analyses of psbA and psaA genes have provided significant support for the monophyly of peridinin- and fucoxanthin-containing dinoflagellates as sister to the haptophytes .

Applications in Research and Biotechnology

The Recombinant Gymnodinium mikimotoi Photosystem Q(B) protein has several important applications in research and biotechnology. As a key component of the photosynthetic apparatus, this protein is valuable for studies of photosynthesis mechanisms, particularly in understanding the unique aspects of photosynthesis in dinoflagellates.

In evolutionary biology, the psbA gene and its encoded protein have been crucial for phylogenetic analyses that have reshaped our understanding of plastid evolution in dinoflagellates and related algal groups. The availability of recombinant versions of this protein facilitates comparative biochemical and structural studies that can provide insights into adaptations of the photosynthetic apparatus across different evolutionary lineages .

Additionally, the protein may be used in the development of enzyme-linked immunosorbent assays (ELISA) for detecting and quantifying Photosystem Q(B) protein in various research contexts, as suggested by the product naming in the commercial offerings .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize repeated freeze-thaw cycles, which can compromise protein integrity.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development during production.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-347
Protein Length
full length protein
Species
Karenia mikimotoi (Red tide dinoflagellate) (Gymnodinium mikimotoi)
Target Names
psbA
Target Protein Sequence
MKSTLLNKKSQQTTPAWEFFCSWVTTTENRLYLGWFGCLMVPTLVSATFAYIIGFLAAPP VDIDGIREPVSGSLLYANNIISGAVIPSSNAMGVHFYPIWEAASLDEWLYNGGTYQLVVF HFFIGVCSYLGREWELSYRLGMRPWIFVAFSAPVAAASAVFIVYPIGQGSFSDGMPLGIS GTFNFMLVFQAEHNILMHPLHMFGVAAVFGGSLFSAMHGSLVTSSLLKETAEFESANYGY RFGQSTETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWLTAMGVSTMAFNL NGLNFQQSILDASGCPINTWADILNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase responsible for using light energy to extract electrons from water, generating oxygen (O2) and a proton gradient. This gradient is subsequently utilized for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the psbA gene in Gymnodinium mikimotoi?

The psbA gene in dinoflagellates like Gymnodinium mikimotoi (also known as Karenia mikimotoi) typically exists as part of a gene family, similar to the organization observed in cyanobacteria. While specific information about G. mikimotoi's psbA gene structure is limited in the available literature, studies on related dinoflagellates provide valuable insights into its likely genomic organization.

In dinoflagellates, plastid genes like psbA have a complex evolutionary history due to their acquisition through endosymbiosis. These genes have undergone considerable rearrangement and adaptation compared to their ancestors. The psbA gene specifically encodes the D1 protein, which forms an essential component of photosystem II (PSII) in the photosynthetic apparatus .

Research on Karenia mikimotoi has confirmed that its plastid transcripts, including those of psbA, undergo post-transcriptional modifications. Specifically, polyuridylylation occurs at the 3' ends of these transcripts, a characteristic shared with Karlodinium veneficum . This unique processing mechanism distinguishes dinoflagellate plastid gene expression from that of other photosynthetic organisms and likely plays a role in transcript stability and translation efficiency.

The evolutionary relationships between G. mikimotoi and other photosynthetic organisms can provide further context for understanding its psbA gene structure. Genome-wide transcript profiling studies have revealed that fucoxanthin dinoflagellates like K. mikimotoi likely acquired their plastid genes through endosymbiosis from haptophyte ancestors, with subsequent gene transfer and modification processes .

What methods are currently used to detect and quantify Gymnodinium mikimotoi in environmental samples?

Several detection methods have been developed for identifying and quantifying Gymnodinium mikimotoi (Karenia mikimotoi) in environmental samples, ranging from traditional microscopy to advanced molecular techniques. Each approach offers distinct advantages depending on research objectives, sample characteristics, and required sensitivity.

Traditional detection methods include light microscopy and electron microscopy, which allow for direct visualization and morphological identification of G. mikimotoi cells. While these approaches remain valuable for basic monitoring, they require significant taxonomic expertise and may be limited in distinguishing between closely related species .

Molecular detection methods have significantly advanced the field, offering improved sensitivity and specificity. Real-time PCR assays targeting species-specific regions of the genome have been widely adopted for quantitative analysis of G. mikimotoi. These approaches typically amplify unique DNA sequences, such as those found in ribosomal DNA or other conserved genes, allowing for precise identification and quantification .

More recently, isothermal amplification techniques have emerged as valuable tools for field-based detection. Methods such as recombinase polymerase amplification (RPA) and loop-mediated isothermal amplification (LAMP) coupled with lateral flow dipstick (LFD) readers provide rapid results without requiring sophisticated thermal cycling equipment, making them suitable for on-site monitoring of harmful algal blooms .

The cutting edge of detection technology now includes CRISPR/Cas-based methods, which offer exceptional specificity and sensitivity. These approaches utilize the programmable nuclease activity of CRISPR systems to detect specific DNA sequences associated with G. mikimotoi, potentially allowing for rapid, field-deployable identification systems with minimal false positives or negatives .

What ecological factors influence Gymnodinium mikimotoi bloom formation?

Gymnodinium mikimotoi bloom formation is governed by a complex interplay of physical, chemical, and biological factors that collectively create favorable conditions for rapid population growth. Understanding these ecological drivers is essential for predicting, monitoring, and potentially mitigating harmful algal blooms.

Temperature plays a critical role in regulating G. mikimotoi growth rates and bloom initiation. Modeling studies along the French Atlantic coast have demonstrated that temperature exerts a strong influence on bloom onset, with specific temperature thresholds triggering accelerated growth. The relationship between temperature and growth rate can be described by a third-order polynomial function, with optimal growth occurring within a defined temperature range that varies somewhat by regional strain adaptation .

Water column stratification and turbulence conditions significantly impact G. mikimotoi bloom development. These dinoflagellates thrive in stratified waters with minimal turbulence, particularly concentrating at pycnocline levels where vertical mixing is reduced. Interestingly, turbulence not only affects cell distribution but also influences mortality rates through a collision-dependent mechanism – increased turbulent kinetic energy dissipation leads to higher shear strain, promoting cell collision and mortality .

Nutrient availability and ratios, particularly nitrogen and phosphorus compounds, are essential factors in bloom development. G. mikimotoi exhibits flexible nutrient uptake capabilities, utilizing both nitrate and ammonium as nitrogen sources. The growth response to nutrients follows Michaelis-Menten kinetics, with specific half-saturation constants (K values) for different nutrient forms. The position of the nutricline relative to the pycnocline is particularly important, as synchronicity between low turbulence conditions and nutrient availability dramatically enhances population growth rates .

Light adaptation represents another key physiological factor in G. mikimotoi ecology. Studies have revealed that these organisms are remarkably adapted to low light intensities, with growth rates increasing with light intensity up to an optimum estimated at approximately 70 μmol·m⁻²·s⁻¹. This adaptation to low light conditions may explain their ability to form subsurface blooms in stratified waters where light penetration is reduced .

How does polyuridylylation of psbA transcripts affect gene expression and protein production in Gymnodinium mikimotoi?

Polyuridylylation of plastid transcripts, including psbA, represents a distinctive post-transcriptional modification in dinoflagellates like Gymnodinium mikimotoi and Karenia mikimotoi. This process involves the addition of poly(U) tails to the 3' ends of transcripts, which has significant implications for transcript stability, processing, and translation efficiency.

Research using circular RNA RT-PCR techniques has confirmed the presence of 3'-terminal poly(U) tails on psbA transcripts in Karenia mikimotoi. These studies have demonstrated that while non-polyuridylylated psbA transcripts can be detected, they typically terminate within the coding sequence (CDS) and likely represent degradation products rather than mature functional transcripts. This suggests that polyuridylylation may be essential for producing stable, translation-competent psbA mRNAs in these organisms .

The evolutionary significance of this modification is substantial, as poly(U) tail addition appears to have been acquired by a common ancestor of extant fucoxanthin dinoflagellates. Comparative genomic analyses indicate that this feature emerged following the endosymbiotic acquisition of a haptophyte plastid, representing a unique adaptation in plastid gene expression regulation. The conservation of this mechanism across related species suggests it provides significant selective advantages in dinoflagellate plastid function .

Sequence analysis of regions surrounding polyuridylylation sites has revealed potential regulatory elements. Studies examining the 3'-UTR sequences and downstream regions of polyuridylylated transcripts have sought to identify primary sequence motifs or RNA secondary structures that might direct the poly(U) polymerase complex to specific sites. The minimum Gibbs free energy of folding in these regions provides insights into potential structural determinants of polyuridylylation efficiency .

What methodological approaches can be used to express and purify recombinant Gymnodinium mikimotoi PsbA protein?

Heterologous expression systems represent the foundation of recombinant PsbA production. While Escherichia coli remains the most commonly used prokaryotic expression host due to its ease of manipulation and rapid growth, membrane proteins like PsbA often form inclusion bodies in this system. Modified E. coli strains (such as C41/C43(DE3) or Lemo21(DE3)) designed specifically for membrane protein expression may improve soluble protein yields. Alternatively, eukaryotic expression systems including yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (using baculovirus vectors), or cell-free translation systems derived from wheat germ or rabbit reticulocyte lysates can provide more suitable environments for proper folding of complex proteins .

Codon optimization is critical when expressing dinoflagellate genes in heterologous systems due to significant differences in codon usage bias. G. mikimotoi, like other dinoflagellates, exhibits unique codon preferences that differ substantially from model expression hosts. Synthetic gene constructs with optimized codons matching the expression host can significantly improve translation efficiency and protein yield. Additionally, incorporation of appropriate affinity tags (such as polyhistidine, FLAG, or Strep-II tags) facilitates subsequent purification while minimizing interference with protein structure and function .

Membrane protein purification requires specialized techniques to maintain stability and activity. Following expression, cell disruption must be performed under gentle conditions to preserve membrane integrity. Extraction typically employs a two-step process: membrane preparation through differential centrifugation followed by solubilization using detergents. Detergent selection is critical - mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often provide the best compromise between extraction efficiency and protein stability. Amphipols or nanodiscs may serve as alternative membrane mimetics during later purification stages .

Chromatographic purification strategies typically combine multiple techniques to achieve high purity. Initial purification often utilizes immobilized metal affinity chromatography (IMAC) if the recombinant protein contains a polyhistidine tag. This may be followed by ion exchange chromatography to separate proteins based on charge differences, and size exclusion chromatography as a final polishing step to remove aggregates and achieve monodispersity. Throughout purification, protein stability must be monitored using techniques such as dynamic light scattering or analytical ultracentrifugation to detect aggregation .

How can we effectively model the dynamics of Gymnodinium mikimotoi blooms to predict their occurrence and distribution?

Modeling Gymnodinium mikimotoi bloom dynamics requires a sophisticated multidisciplinary approach that integrates hydrodynamic, biogeochemical, and species-specific biological components. Effective predictive models must account for the complex interplay between physical oceanographic processes, nutrient cycling, and the unique physiological characteristics of G. mikimotoi.

Three-dimensional coupled physical-biological models represent the most comprehensive approach to simulating G. mikimotoi bloom dynamics. Studies along the French Atlantic coast have successfully employed models that integrate hydrodynamic components (simulating water movement, mixing, and stratification) with biological modules specific to G. mikimotoi physiology. These models incorporate transport, diffusion, and heat flux calculations to create realistic simulations of the marine environment. The biological component typically includes cycling of key limiting nutrients (nitrogen, phosphorus, and silicon) alongside species-specific growth and mortality parameters .

Parameterization of G. mikimotoi-specific physiological responses is critical for model accuracy. Key parameters include:

ParameterValue/FormulaSignificance
Light responseGrowth optimal at 70 μmol·m⁻²·s⁻¹Determines vertical distribution and bloom timing
Temperature functionThird-order polynomialStrong influence on bloom onset
Mortality rateFunction of cell concentration and turbulence (shear strain γ)Controls vertical distribution
Chlorophyll a/cell ratio~100,000 unitsAllows conversion between biomass and cell density
Nutrient limitationf(N)=min(f(1),f(2)) where f(1) and f(2) are Michaelis-Menten functionsDetermines nutrient uptake dynamics

These parameters are typically derived from laboratory culture studies and field observations, providing a physiological foundation for predictive modeling .

Turbulence and stratification modeling is particularly important for accurately simulating G. mikimotoi blooms. The species thrives in regions of minimal turbulence, typically at pycnocline levels, where cell collision-induced mortality is reduced. Models must accurately represent the shear strain (γ) estimated from turbulent kinetic energy dissipation rate (ε) and kinematic viscosity (ν). Additionally, incorporating the synchronicity between low turbulence conditions and nutricline position is essential for capturing the environmental conditions that enhance survival rates .

Model validation requires comparison against comprehensive field monitoring data. Historical bloom data from surveillance networks, such as the French REPHY network, provide valuable benchmarks for assessing model performance. Validation should examine not only the presence/absence of blooms but also their timing, magnitude, spatial extent, and vertical distribution. Current models can successfully reproduce sub-surface cell concentrations in zones of minimal turbulence, though they sometimes underestimate maximum cell densities observed in natural blooms .

What techniques can be used to study the role of PsbA in photoadaptation of Gymnodinium mikimotoi to different light conditions?

Investigating the role of PsbA in photoadaptation of Gymnodinium mikimotoi requires a multifaceted approach combining molecular, biochemical, biophysical, and physiological techniques. These methodologies enable researchers to understand how variations in PsbA structure and function contribute to this dinoflagellate's remarkable ability to adapt to diverse light environments.

Quantitative proteomics approaches provide essential insights into PsbA protein dynamics under varying light conditions. Reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS) techniques have been successfully employed to quantify PsbA protein isoforms in photosynthetic organisms, overcoming challenges related to high sequence similarity between variants. This approach allows researchers to track changes in the relative abundance of specific PsbA isoforms in response to environmental stimuli, particularly important when investigating photoadaptation mechanisms . Sample preparation typically involves membrane protein extraction using specialized buffers containing detergents like n-dodecyl-β-D-maltoside, followed by proteolytic digestion and analysis of signature peptides unique to each isoform.

Transcript analysis using quantitative RT-PCR and circular RNA RT-PCR techniques enables monitoring of psbA gene expression patterns under different light regimes. These approaches can reveal differential expression of specific isoforms, providing insights into transcriptional regulation mechanisms. Importantly, studying the relationship between transcript abundance and protein levels through parallel analysis allows researchers to distinguish between transcriptional and post-transcriptional regulatory mechanisms governing PsbA accumulation during photoadaptation .

Biophysical characterization of photosystem II function under varying light conditions provides direct evidence of PsbA-mediated adaptations. Techniques include:

These approaches allow researchers to correlate structural variations in PsbA with functional adaptations in photosynthetic electron transport, particularly important when examining adaptation to different light intensities .

Genetic manipulation approaches, although challenging in dinoflagellates, offer powerful tools for elucidating PsbA function. Where transformation systems exist, creation of knock-out or knock-down mutants using CRISPR/Cas9 or RNA interference technologies can provide definitive evidence of specific PsbA isoform functions. Alternatively, heterologous expression of G. mikimotoi PsbA variants in model organisms with established transformation systems can enable comparative functional analysis .

How does the life cycle of Gymnodinium mikimotoi, particularly cyst formation, contribute to recurring bloom dynamics?

The life cycle of Gymnodinium mikimotoi, particularly its capacity for cyst formation, plays a crucial role in bloom dynamics, persistence, and geographical distribution. Recent research has resolved longstanding questions about the organism's life cycle strategies, providing key insights into bloom recurrence mechanisms.

Sexual reproduction and cyst formation in G. mikimotoi have been definitively confirmed through comprehensive microscopic and molecular analyses. Laboratory culture observations have documented the complete sexual cycle, including cell pairs engaged in sexual mating, cell fusion, formation of planozygotes (identifiable by their two longitudinal flagella), and the production of thin-walled resting cysts. These processes occur homothallically, meaning sexual reproduction can take place within a single strain without requiring genetically distinct mating types. The germination process has also been observed, with emerging germlings exhibiting two longitudinal flagella, confirming their zygotic nature .

Field verification of G. mikimotoi cysts has employed multiple complementary techniques to overcome the challenges of identifying morphologically cryptic cysts in complex sediment samples. These approaches include:

  • PCR detection using species-specific primers designed to target unique genomic regions

  • Fluorescence in situ hybridization (FISH) using oligonucleotide probes targeting the LSU rDNA D2 domain

  • Light microscopic observation of cysts labeled with FISH probes

  • Single-cell PCR sequencing of FISH-labeled cysts for definitive species identification

This multi-method approach has conclusively demonstrated the presence of G. mikimotoi cysts in marine sediments from regions experiencing recurrent blooms .

The ecological significance of cyst formation extends to several aspects of bloom dynamics. As overwintering strategies, cysts provide a mechanism for population persistence through unfavorable environmental conditions, serving as inoculum for subsequent bloom formation when conditions improve. The discovery of viable cysts in marine sediments from areas experiencing recurrent blooms provides a mechanistic explanation for annual bloom cycles in specific regions .

Geographic distribution patterns of G. mikimotoi blooms may be partially explained by cyst dispersal mechanisms. The documented global expansion of G. mikimotoi blooms over recent decades likely involves a combination of natural dispersal via ocean currents and anthropogenic transport (e.g., in ship ballast water). The ability to form resistant cysts enhances long-distance dispersal potential, potentially explaining the species' success in colonizing new regions worldwide .

What techniques can be used to isolate and culture Gymnodinium mikimotoi for experimental studies?

Isolation from natural samples typically employs a combination of techniques. Initial sample collection should target water from active bloom areas or known G. mikimotoi habitats, ideally during early bloom stages when populations are actively growing. Filtration through appropriate mesh sizes (typically 100-200 μm) helps remove larger zooplankton while retaining the target dinoflagellate cells. Single-cell isolation techniques, including micropipetting, flow cytometry with cell sorting, or serial dilution, can then be used to establish clonal cultures. For micropipetting, individual cells are visualized under an inverted microscope and carefully transferred through several washing steps using finely drawn Pasteur pipettes or microcapillary tubes .

Media selection and optimization significantly impact culture success. Modified f/2 medium supplemented with soil extract or L1 medium typically provides suitable nutrient conditions for G. mikimotoi growth. The media should be prepared using filtered natural seawater (ideally collected from the same region as the isolated cells) with a salinity of approximately 30-35 practical salinity units (PSU). Sterilization through autoclaving or filtration (0.22 μm) is essential, though certain heat-labile nutrients may need to be filter-sterilized separately and added after autoclaving. Trace metal and vitamin supplementation, particularly B12, biotin, and thiamine, is critical for sustained growth .

Culture maintenance requires careful attention to environmental parameters. Optimal conditions typically include:

ParameterRecommended RangeNotes
Temperature15-20°CStrain-dependent variation exists
Light intensity50-100 μmol·m⁻²·s⁻¹Lower intensities (≈70 μmol·m⁻²·s⁻¹) often optimal
Light cycle12:12 or 14:10 L:DDiurnal cycle important for normal physiology
pH8.0-8.4Buffer addition may be necessary
TurbulenceMinimalGentle swirling only; avoid aeration

Cultures should be maintained in appropriate vessels (tissue culture flasks or glass Erlenmeyer flasks) and transferred to fresh media every 2-3 weeks during exponential growth phase. Monitoring cell concentration, morphology, and mobility is essential for assessing culture health .

Contamination control represents a significant challenge in G. mikimotoi cultivation. Antibiotic treatment using a cocktail of broad-spectrum antibiotics (e.g., penicillin, streptomycin, gentamicin) can help eliminate bacterial contaminants, though prolonged antibiotic exposure should be avoided. For fungal contamination, antifungal agents like amphotericin B may be employed cautiously. Physical separation techniques, including density gradient centrifugation or fluorescence-activated cell sorting, can also help purify cultures. Regular microscopic examination using phase contrast or differential interference contrast microscopy allows early detection of contamination .

How can we analyze the expression patterns of different psbA gene variants in Gymnodinium mikimotoi under varying environmental conditions?

Analyzing expression patterns of psbA gene variants in Gymnodinium mikimotoi requires sophisticated molecular techniques that can distinguish between highly similar sequences while providing quantitative data on their relative abundance under different environmental conditions. These approaches enable researchers to understand how differential expression of psbA variants contributes to photoacclimation and stress responses.

RNA extraction and quality assessment form the critical first step in expression analysis. Working with dinoflagellates presents unique challenges due to their tough cell walls and high content of secondary metabolites and RNases. Optimized extraction protocols typically employ chaotropic agents like guanidinium thiocyanate combined with phenol-chloroform extraction, often using commercial kits modified specifically for recalcitrant algal samples. RNA quality assessment via spectrophotometric analysis (A260/A280 and A260/A230 ratios) and electrophoresis is essential before proceeding to downstream applications. DNase treatment is particularly important to remove genomic DNA contamination that could interfere with transcript quantification .

Transcript-specific RT-PCR approaches enable detection and quantification of different psbA variants despite their high sequence similarity. This requires careful primer design targeting unique regions that differentiate between variants, often in untranslated regions rather than the highly conserved coding sequences. For highly similar variants, techniques like high-resolution melt curve analysis following qPCR can differentiate amplicons based on slight differences in melting temperature profiles. Digital PCR provides another alternative, offering absolute quantification without requiring standard curves and demonstrating higher tolerance to PCR inhibitors commonly present in algal samples .

Circular RNA RT-PCR provides valuable insights into transcript termini, particularly important when studying post-transcriptional modifications like polyuridylylation. This approach involves circularization of RNA molecules using RNA ligase, followed by RT-PCR with outward-facing primers that amplify across the ligated junction. For psbA transcripts in dinoflagellates like Karenia mikimotoi, this technique has confirmed the presence of 3'-terminal poly(U) tails, distinguishing mature transcripts from degradation products. The method can be adapted to compare transcript processing under different environmental conditions, providing insights into post-transcriptional regulatory mechanisms .

RNA-Seq and differential expression analysis offer genome-wide perspectives on transcript abundance patterns. While requiring substantial bioinformatic expertise, these approaches provide comprehensive views of expression dynamics across the transcriptome. For psbA variant analysis, specialized pipelines incorporating de novo transcript assembly and careful sequence alignment parameters are necessary to accurately distinguish between highly similar variants. Differential expression analysis using packages like DESeq2 or edgeR can then identify statistically significant changes in expression levels across experimental conditions .

Correlation of transcript abundance with protein levels provides essential context for understanding the functional significance of differential gene expression. This integrative approach combines transcript quantification methods with protein quantification techniques such as targeted proteomics (RP-LC-ESI-MS/MS). Such analyses have revealed important insights in other photosynthetic organisms, such as Thermosynechococcus elongatus, where changes in psbA transcripts correspond to shifts in PsbA protein isoform abundance, particularly under high light stress conditions .

What bioinformatic approaches can be used to analyze the evolutionary history of psbA genes in dinoflagellates like Gymnodinium mikimotoi?

Bioinformatic analysis of psbA evolutionary history in dinoflagellates requires specialized approaches to address the complex genomic architecture and unique evolutionary processes in these organisms. These computational methods enable researchers to reconstruct phylogenetic relationships, identify selection pressures, and uncover horizontal gene transfer events that have shaped psbA evolution.

Sequence retrieval and database construction form the foundation of evolutionary analyses. Comprehensive datasets should include psbA sequences from diverse dinoflagellate lineages, with particular emphasis on fucoxanthin-containing species like Gymnodinium mikimotoi, Karenia mikimotoi, and Karlodinium veneficum. These should be complemented with sequences from potential endosymbiotic sources, including haptophytes (e.g., Emiliania huxleyi, Phaeocystis globosa, Pavlova lutheri) and other algal lineages. Public databases like GenBank provide a starting point, though these may need supplementation with sequences from transcriptome and genome projects accessible through specialized databases like MMETSP (Marine Microbial Eukaryote Transcriptome Sequencing Project) .

Multiple sequence alignment requires careful parameter optimization when working with dinoflagellate sequences. Progressive alignment algorithms (e.g., MUSCLE, MAFFT) with iterative refinement are typically most effective for genes like psbA. For coding sequences, translation alignment approaches that align amino acid sequences before reverting to nucleotides help maintain coding frame integrity. After initial alignment, manual curation in visualization tools like Jalview or Geneious is often necessary to correct misaligned regions, particularly at intron-exon boundaries or areas with insertion/deletion events. Alignment quality can be objectively assessed using metrics such as TCS (transitive consistency score) or GUIDANCE .

Phylogenetic reconstruction methods must be selected based on the specific characteristics of dinoflagellate sequences and the evolutionary questions being addressed. Maximum likelihood approaches implemented in tools like RAxML or IQ-TREE are widely used, with model selection tools (e.g., ModelFinder) identifying appropriate substitution models. Bayesian inference methods (MrBayes, BEAST) offer additional advantages for estimating divergence times when calibration points are available. For complex evolutionary scenarios involving horizontal gene transfer, reconciliation methods that compare gene trees with species trees can identify discordant patterns indicative of non-vertical inheritance .

Detection of recombination events is particularly important when analyzing genes potentially affected by horizontal gene transfer. Methods implemented in packages like RDP4 employ multiple algorithms (RDP, GENECONV, MaxChi, Chimaera, 3Seq) to identify potential recombination breakpoints. For psbA genes in dinoflagellates like Karenia mikimotoi, comparison with potential donor lineages such as haptophytes can reveal mosaic patterns indicative of recombination following endosymbiotic gene transfer. These analyses are critical for understanding the chimeric nature of dinoflagellate plastid genomes .

Selection pressure analysis provides insights into the functional constraints and adaptive evolution of psbA. Codon-based methods implemented in packages like PAML or HyPhy can calculate dN/dS ratios (ω) across lineages and specific sites within the protein. Site-specific models can identify positions under positive selection, while branch-site models can detect episodic selection affecting particular lineages. For transmembrane proteins like PsbA, integrating structural information into selection analyses helps contextualize adaptive changes in terms of functional domains, cofactor binding sites, and protein-protein interaction interfaces .

How can CRISPR/Cas-based methods be adapted for detecting Gymnodinium mikimotoi in environmental samples?

CRISPR/Cas-based detection methods represent a cutting-edge approach for identifying Gymnodinium mikimotoi in environmental samples, offering exceptional specificity, sensitivity, and potential for field deployment. Adapting these systems for algal detection requires careful consideration of target selection, sample preparation, assay design, and signal detection strategies.

Target sequence selection is the critical first step in developing CRISPR/Cas detection methods for G. mikimotoi. Ideal targets include species-specific genomic regions with sufficient sequence divergence from related species to ensure specificity while maintaining conservation within G. mikimotoi strains to avoid false negatives. The internal transcribed spacer (ITS) regions of ribosomal DNA, plastid genes with unique sequence signatures, or mitochondrial markers often serve as excellent candidates. For each potential target, comprehensive bioinformatic analysis including multiple sequence alignment and specificity validation against databases is essential to ensure the selected region will enable unambiguous identification .

CRISPR/Cas system selection should be based on the specific requirements of environmental sampling. While several CRISPR/Cas variants exist, Cas12a (previously known as Cpf1) has proven particularly effective for nucleic acid detection applications. This system exhibits robust collateral cleavage activity upon target recognition – when Cas12a binds its target DNA, it activates indiscriminate single-stranded DNA (ssDNA) cleavage. This unique property enables signal amplification through reporter systems using fluorophore-quencher pairs linked by ssDNA, which are cleaved upon target detection, releasing detectable fluorescent signals .

Sample preparation protocols must be optimized for marine environmental samples. This typically involves:

  • Filtration of water samples (typically 50-100 mL) through 0.45-0.22 μm filters to capture cells

  • Direct lysis on filters using buffers containing detergents, chaotropic agents, and proteinase K

  • Nucleic acid extraction using silica column-based methods or magnetic bead-based approaches

  • Optional target pre-amplification using isothermal amplification methods like recombinase polymerase amplification (RPA) to enhance sensitivity

These procedures must be designed to minimize contamination risks while maximizing DNA recovery from potentially low-abundance targets .

Assay configuration for field-deployable applications requires careful optimization of reaction components. A typical CRISPR/Cas12a-based detection system for G. mikimotoi would include:

ComponentFunctionOptimization Considerations
Cas12a proteinTarget recognition and cleavageConcentration, storage stability
CRISPR RNA (crRNA)Guides Cas12a to targetSequence design, secondary structure
Reporter moleculeSignal generationFluorophore-quencher selection, sensitivity
Buffer systemMaintains optimal reaction conditionspH, ionic strength, additives for stability
Optional RPA componentsTarget pre-amplificationPrimer design, reaction temperature

Each component requires careful optimization for specificity, sensitivity, and robustness under field conditions .

Signal detection and quantification strategies must be adapted to the intended use case. For laboratory-based applications, standard fluorescence plate readers or qPCR instruments can measure fluorescence signals from reporter cleavage. For field applications, portable fluorescence readers, smartphone-based detection systems, or lateral flow strips detecting cleaved reporters offer viable alternatives. These approaches can potentially provide not only qualitative (presence/absence) results but also semi-quantitative estimation of cell abundance based on signal intensity calibration .

What methods can be used to study the three-dimensional structure and functional domains of the PsbA protein in Gymnodinium mikimotoi?

Determining the three-dimensional structure and functional architecture of the PsbA protein in Gymnodinium mikimotoi requires an integrated approach combining experimental structural biology techniques with computational prediction methods. These approaches provide complementary insights into protein structure across different resolution scales.

X-ray crystallography remains the gold standard for high-resolution structural determination of proteins, including membrane proteins like PsbA. This approach requires production of highly pure, homogeneous protein samples that can form well-ordered crystals. For PsbA, this typically involves recombinant expression, extraction using appropriate detergents, and extensive purification. Crystallization trials explore various conditions (detergents, lipids, precipitants, pH, temperature) to identify those promoting crystal formation. While challenging for membrane proteins, successful crystallization enables atomic-resolution structures revealing precise arrangements of amino acids, cofactor binding sites, and protein-protein interaction interfaces. Structure determination of PsbA within the context of the complete photosystem II complex provides particularly valuable insights into its functional architecture .

Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative for structural studies of membrane proteins, particularly large complexes like photosystem II. This technique visualizes flash-frozen protein samples in their native-like environment without requiring crystallization. Recent advances in direct electron detectors and image processing algorithms have enabled near-atomic resolution structures, revealing detailed structural features of membrane protein complexes. For G. mikimotoi PsbA, cryo-EM offers the advantage of potentially visualizing the protein within its native lipid environment and in complex with its interaction partners, providing insights into both structure and physiologically relevant conformational states .

Molecular dynamics (MD) simulations complement static structural information by modeling protein behavior over time. For membrane proteins like PsbA, specialized MD approaches incorporating explicit membrane bilayers and solvation models can simulate the protein's dynamics in a realistic environment. These simulations can reveal conformational flexibility, water and ion accessibility pathways, lipid-protein interactions, and the effects of mutations or environmental conditions on protein stability. For G. mikimotoi PsbA, MD simulations could provide particular insights into adaptations for functioning under specific light or temperature conditions characteristic of its ecological niche .

Structure-function correlation approaches connect structural insights with experimental functional data. These typically involve site-directed mutagenesis of specific residues identified through structural studies, followed by functional assays examining effects on photosynthetic electron transport, oxygen evolution, or herbicide binding. Specific techniques might include:

  • Thermoluminescence measurements to assess changes in redox potentials

  • Fluorescence decay kinetics to examine electron transfer rates

  • Oxygen evolution assays to quantify water-splitting activity

  • Herbicide binding studies to characterize interaction with electron transport inhibitors

By correlating structural features with functional outcomes, these approaches enable mechanistic understanding of how specific adaptations in G. mikimotoi PsbA contribute to its photosynthetic performance under varying environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.