Recombinant Habromys lophurus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ND3 and Habromys lophurus

MT-ND3 represents one of the core subunits of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), believed to be integral to the minimal assembly required for catalytic activity. This protein functions primarily in the transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor . The significance of this protein extends beyond its bioenergetic functions to its utility in evolutionary and taxonomic studies.

Habromys lophurus, commonly known as the crested-tailed deer mouse, represents one of the seven described species within the genus Habromys, belonging to the Neotominae subfamily of the Cricetidae family. These arboreal mice are among the most poorly known Neotropical rodents, with distributions ranging from Mexico to Central America . The species has gained attention in evolutionary studies, particularly for understanding phylogenetic relationships through mitochondrial gene analyses.

The recombinant expression of MT-ND3 from Habromys lophurus provides researchers with a valuable tool for studying both the functional aspects of this critical mitochondrial protein and its evolutionary significance within rodent taxonomy. This protein serves as a model for understanding the broader implications of mitochondrial genetics and bioenergetics across mammalian species.

Expression Systems and Methods

The recombinant Habromys lophurus MT-ND3 protein is typically expressed in E. coli expression systems, offering advantages in terms of yield, cost-effectiveness, and scalability . The expression construct typically includes the full-length (1-115 amino acids) sequence fused to an N-terminal histidine tag to facilitate purification and detection .

Commercial preparations of this recombinant protein are commonly supplied as lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis . This form provides stability during shipping and storage while allowing flexibility in reconstitution for various research applications.

Role in Mitochondrial Respiration

MT-ND3 serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . This complex represents the first and largest enzyme in the electron transport chain, playing a crucial role in cellular respiration and energy production. The primary function of Complex I involves the transfer of electrons from NADH to ubiquinone while simultaneously pumping protons across the inner mitochondrial membrane .

The specific role of MT-ND3 within this complex relates to its position in the membrane domain, contributing to the proton-pumping machinery that generates the electrochemical gradient necessary for ATP synthesis. This function is essential for cellular energy metabolism across all eukaryotic organisms that possess mitochondria.

Evolutionary Significance

The MT-ND3 gene has proven valuable in phylogenetic studies, particularly for understanding evolutionary relationships among closely related species. In the context of Habromys species, mitochondrial genes including ND3 have been utilized to investigate species-level phylogenetic relationships .

Studies involving the complete mitochondrial ND3 gene sequencing in related rodent species, such as South American marsh rats (genus Holochilus), have revealed patterns of nonneutral evolution in mitochondrial DNA . These analyses have demonstrated interesting evolutionary patterns, including a greater number of amino acid polymorphisms within species than expected based on interspecific comparisons, suggesting the presence of mildly deleterious mutations .

Current Applications in Molecular Research

The recombinant Habromys lophurus MT-ND3 protein serves multiple research purposes, with SDS-PAGE analysis being a primary application as indicated in commercial product specifications . This application is particularly useful for studying protein expression, purity, and molecular weight characteristics.

Beyond basic protein analysis, this recombinant protein may serve as:

  • A positive control in immunological assays targeting conserved regions of MT-ND3

  • A standard for studying protein-protein interactions within mitochondrial complexes

  • A tool for generating antibodies against specific epitopes of the MT-ND3 protein

  • A model for structural studies of membrane-embedded mitochondrial proteins

Phylogenetic and Evolutionary Studies

The MT-ND3 gene has demonstrated significant utility in phylogenetic analyses of rodent species. Research involving the Habromys genus has employed mitochondrial ND3 and ND4 regions (1331 aligned bases) to investigate species-level relationships among the seven described Habromys species .

These molecular studies have verified the monophyly of the Habromys genus within the Neotomines and identified distinct phylogenetic patterns. Specifically, the northernmost H. simulatus has been identified as sister to the remaining species, while the southernmost clade (Oaxaca to Central America, which includes H. lophurus) forms a sister relationship with the Transmexican Volcanic Belt clade .

Comparison with MT-ND3 from Related Species

Comparing the MT-ND3 protein across different species offers insights into evolutionary conservation and functional significance of specific residues. The table below presents a comparison between Habromys lophurus MT-ND3 and the corresponding protein from Dasypus novemcinctus (Nine-banded armadillo):

FeatureHabromys lophurus MT-ND3Dasypus novemcinctus MT-ND3
Protein Length115 amino acids115 amino acids
UniProt IDO21610O21332
First 10 AAMNMLVALSVNMNIMITLFIN
Last 10 AAYEWMQKGLEWTEYEWLQKGLEWNE
Expression SystemE. coliE. coli
Recombinant TagHisHis

Evolutionary Patterns in MT-ND3

Studies examining mitochondrial sequence evolution in rodent species have revealed interesting patterns relevant to understanding MT-ND3 evolution. Analysis of the complete mitochondrial ND3 gene in South American marsh rats (genus Holochilus) has shown departures from neutral evolution models .

Specifically, researchers observed more amino acid polymorphisms within species than expected based on interspecific comparisons, suggesting the presence of mildly deleterious mutations . Multiple tests of frequency distribution revealed departures from neutral, equilibrium models for both nonsynonymous and synonymous sites, typically showing an excess of rare sites . These patterns are consistent with either a recent selective sweep or populations not at mutation-drift equilibrium.

Quality Control and Validation

Commercial preparations of recombinant MT-ND3 protein typically undergo quality control testing to ensure purity and integrity. Standard validation includes:

  1. SDS-PAGE analysis to confirm purity greater than 90%

  2. Size verification to confirm the expected molecular weight

  3. Tag detection to confirm the presence and accessibility of the His-tag

  4. Functional testing where applicable

Researchers should perform additional validation specific to their experimental requirements, particularly if the protein will be used in specialized applications beyond standard SDS-PAGE analysis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Habromys lophurus (Crested-tailed deer mouse)
Target Names
Target Protein Sequence
MNMLVALSVNIALSMCLITIAFWLPQLNMYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMNNINTMMLTSFILVSVLALGLAYEWMQKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its role in mitochondrial function?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is an essential component of mitochondrial Complex I, which forms part of the respiratory chain responsible for cellular energy production. This 115 amino acid protein is encoded by the mitochondrial genome and plays a crucial role in the electron transport chain. MT-ND3 contains a conserved loop structure that is involved in the active/deactive state transition of Complex I . This functional region is critical for regulating the activity of the entire complex in response to cellular energy demands and environmental conditions.

How is recombinant Habromys lophurus MT-ND3 typically expressed?

Recombinant Habromys lophurus MT-ND3 is commonly expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The typical workflow involves:

  • Cloning the MT-ND3 gene into an appropriate expression vector

  • Transformation into a compatible E. coli strain

  • Induction of protein expression (often using IPTG)

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (His-tag binding)

  • Quality assessment via SDS-PAGE (>90% purity is generally expected)

  • Lyophilization for storage stability

The recombinant protein is typically stored as a lyophilized powder and reconstituted in deionized water to concentrations of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

How can researchers optimize the storage and handling of recombinant MT-ND3 protein?

Optimal storage and handling of recombinant MT-ND3 protein requires careful attention to several factors:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for up to one week

  • Use Tris/PBS-based buffer at pH 8.0 with 6% trehalose for optimal stability

Repeated freeze-thaw cycles should be strictly avoided as they significantly diminish protein activity and structural integrity.

What are the common applications of recombinant MT-ND3 in research?

Recombinant MT-ND3 proteins serve several critical research applications:

  • Structural studies: Understanding the three-dimensional structure of Complex I components

  • Functional assays: Measuring electron transport activity and NADH dehydrogenase function

  • Antibody production: Generating specific antibodies for immunological studies

  • Protein-protein interaction studies: Identifying binding partners within Complex I

  • Evolutionary analysis: Comparing sequences across species to track evolutionary changes

  • Mutation analysis: Studying the impact of naturally occurring or engineered mutations

Most commonly, researchers initially verify the protein's integrity and purity through SDS-PAGE analysis before proceeding to more complex experimental applications .

How does MT-ND3 sequence variation compare between different rodent species?

MT-ND3 sequence analysis across rodent species reveals important patterns of evolutionary conservation and variation:

  • Highly conserved functional regions, particularly in the loop domain involved in Complex I active/deactive transitions, show minimal variation across species

  • Studies in South American marsh rats (Holochilus) have shown a greater number of amino acid polymorphisms within species than expected based on interspecific comparisons

  • Analysis of synonymous vs. nonsynonymous changes suggests that many amino acid polymorphisms are under selective pressure and are likely mildly deleterious

For example, comparative studies between Holochilus brasiliensis and H. vulpinus revealed departures from a neutral, equilibrium model in both nonsynonymous and synonymous sites, with an excess of rare variants suggesting either recent selective sweeps or populations not at mutation-drift equilibrium .

What methods are most effective for analyzing selective pressure on MT-ND3 genes?

Several complementary approaches are recommended for analyzing selective pressure on MT-ND3:

  • Nonsynonymous/synonymous ratio analysis: Compare the ratio of nonsynonymous to synonymous nucleotide changes within and between species (as done in Holochilus studies)

  • Frequency distribution tests: Analyze the distribution of rare vs. common variants to detect departures from neutral models

  • Contingency table analysis: Test whether amino acid polymorphisms are distributed as expected under neutrality

  • Comparative genomics: Align sequences across multiple species to identify conserved regions under purifying selection

  • Population genetics metrics: Calculate Tajima's D, Fu and Li's F, and other statistical tests to detect selection signatures

These methods, when used in combination, can provide robust evidence for non-neutral evolution and help identify regions under different types of selection pressure .

How can mitochondrial base editing be used to study MT-ND3 function?

Mitochondrial base editing represents a cutting-edge approach to study MT-ND3 function through precise genetic modifications:

  • DdCBE (DddA-derived cytosine base editors) can target specific cytosine residues in the mitochondrial genome for C-to-T conversion

  • These editors can be designed with TALE domains binding to mtDNA light and heavy strands flanking the target sequence

  • For example, DdCBE-Nd3-9577 pairs can target positions in MT-Nd3 that result in specific amino acid changes (e.g., G40K, G40E, or G40*)

The methodology involves:

  • Designing TALE binding domains specific to sequences flanking the target cytosines

  • Creating DdCBE pairs with appropriate DddA toxin splits

  • Delivering the editors via transient transfection or AAV vectors

  • Verifying editing efficiency through NGS analysis

  • Monitoring the phenotypic consequences of the introduced mutations

In mouse models, this approach achieved approximately 43% editing efficiency for specific cytosine targets, with 92.5% of edited reads containing the desired G40K mutation .

What are the considerations for AAV-mediated delivery of MT-ND3 editing tools in vivo?

For researchers planning AAV-mediated delivery of MT-ND3 editing tools, several critical factors should be considered:

  • Age of experimental subjects: Studies show that younger subjects generally exhibit higher editing efficiency (62-70% in 2-week-old mice vs. 28-50% in 7-week-old mice)

  • Vector design: AAV vectors containing DdCBE components must be optimized for packaging capacity and tissue tropism

  • Delivery route: Systemic delivery via tail vein injection can reach multiple tissues, but targeted delivery may be required for tissue-specific effects

  • Dosage optimization: Careful titration of viral dose is necessary to maximize editing efficiency while minimizing potential toxicity

  • Timing of analysis: Typically, analysis is performed 4-8 weeks post-injection to allow sufficient time for editing and mtDNA turnover

  • mtDNA copy number monitoring: It's essential to verify that editing does not significantly affect mtDNA abundance

A comprehensive experimental design should include appropriate controls, including catalytically inactive DdCBE variants and vehicle-injected control groups.

What techniques are recommended for analyzing MT-ND3 mutations in natural populations?

For researchers studying MT-ND3 mutations in natural populations, the following methodological workflow is recommended:

  • Sample collection and DNA extraction:

    • Collect tissue samples from representative individuals across populations

    • Extract total DNA using methods that preserve mitochondrial DNA integrity

  • PCR amplification and sequencing:

    • Design primers flanking the complete MT-ND3 gene

    • Amplify using high-fidelity polymerase to minimize errors

    • Perform Sanger sequencing for initial screening or targeted amplicon resequencing for population-level studies

  • Data analysis:

    • Generate count tables using tools like samtools mpileup (-q 30) and varscan

    • Calculate nucleotide diversity (π) within populations

    • Compare nonsynonymous/synonymous ratios within and between species

    • Perform statistical tests for neutrality (e.g., McDonald-Kreitman test)

  • Phylogenetic analysis:

    • Construct haplotype networks to visualize relationships

    • Perform tests of the frequency distribution to detect departures from neutrality

This approach was successfully applied to analyze MT-ND3 in 82 Holochilus brasiliensis and 21 H. vulpinus samples, revealing patterns of non-neutral evolution .

How can researchers effectively analyze the functional consequences of MT-ND3 mutations?

A comprehensive approach to analyzing the functional consequences of MT-ND3 mutations should include:

  • In silico analysis:

    • Predict the impact of mutations on protein structure using molecular modeling

    • Assess conservation of affected residues across species

    • Predict functional consequences using tools like PROVEAN, PolyPhen, etc.

  • In vitro functional assays:

    • Express wild-type and mutant proteins in appropriate systems

    • Measure Complex I assembly efficiency via Blue Native PAGE

    • Assess electron transport activity using spectrophotometric assays

    • Evaluate ROS production in cellular models

  • In vivo studies:

    • Generate mouse models with specific mutations via mitochondrial base editing

    • Assess phenotypic consequences in relevant tissues

    • Measure mitochondrial respiration in isolated mitochondria

    • Analyze metabolic parameters in whole organisms

For example, mutations in the conserved ND3 loop involved in active/deactive state transition of Complex I have been shown to significantly impact enzyme function and may contribute to pathological conditions .

How should experiments be designed to distinguish between neutral and selective evolution in MT-ND3?

To effectively distinguish between neutral and selective evolution in MT-ND3, researchers should design experiments that:

  • Sample multiple populations and related species:

    • Include sufficient samples from each population (e.g., 82 H. brasiliensis and 21 H. vulpinus)

    • Sample related species for interspecific comparisons

  • Apply complementary statistical tests:

    • McDonald-Kreitman test to compare intraspecific polymorphism and interspecific divergence

    • Tests of frequency distribution to detect departures from neutral models

    • Analysis of synonymous vs. nonsynonymous substitution patterns

  • Control for population history:

    • Use multiple neutral loci to establish baseline expectations

    • Account for demographic factors that might mimic selection signals

    • Consider analyses that are robust to population size changes

  • Examine patterns across the gene:

    • Analyze variation in different functional domains

    • Compare patterns in MT-ND3 with other mitochondrial genes

    • Test specific hypotheses about functional constraints

When properly designed, such studies can reveal patterns like those observed in Holochilus, where an excess of rare sites suggested either recent selective sweeps or non-equilibrium population dynamics .

What are the key considerations when interpreting contradictory results from MT-ND3 mutation studies?

When faced with contradictory results from MT-ND3 mutation studies, researchers should consider:

  • Methodological differences:

    • Sequencing technologies and depth of coverage

    • Statistical methods and significance thresholds

    • Sample sizes and population representation

  • Biological factors:

    • Species-specific differences in selective pressures

    • Nuclear-mitochondrial interactions

    • Environmental context of the populations studied

    • Background genetic variation

  • Alternative hypotheses:

    • Population history effects vs. selection

    • Different types of selection operating simultaneously

    • Indirect selection due to linkage with other mitochondrial genes

  • Resolution approaches:

    • Meta-analysis of multiple studies

    • Direct replication with standardized methods

    • Complementary functional studies to assess phenotypic effects

    • Expanded sampling to include more populations or species

For example, contradictory results about the neutrality of MT-ND3 mutations could be resolved by examining whether patterns of amino acid polymorphism vary across functional domains or by testing whether specific mutations affect protein function through in vitro assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.