Recombinant Hadronyche versuta Kappa-hexatoxin-Hv1a

Shipped with Ice Packs
In Stock

Description

Definition and Origin

Kappa-hexatoxin-Hv1a (UniProt: P82227) is a 37-residue peptide stabilized by four disulfide bonds . It belongs to the kappa-hexatoxin family, which selectively inhibits insect voltage-gated potassium (Kv) channels, leading to paralysis and death in arthropods . The recombinant form (rK-HXTX-Hv1a) is produced via heterologous expression systems such as E. coli, yeast, or insect cells, enabling scalable production for research and biopesticide development .

Primary Structure

The peptide sequence is SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD, featuring:

  • Four disulfide bonds (Cys1–Cys4, Cys2–Cys5, Cys3–Cys6, Cys7–Cys8) .

  • An inhibitor cystine knot (ICK) motif, common in spider-venom peptides, enhancing stability .

Mechanism of Action

rK-HXTX-Hv1a blocks insect Kv channels, disrupting nerve signal transmission . Unlike omega-hexatoxins (which target calcium channels), kappa-hexatoxins exhibit high selectivity for potassium channels in pests like Drosophila suzukii and Myzus persicae (aphids) .

Production Methods

Recombinant production involves:

ParameterDetails
Expression SystemsE. coli (most common), Pichia pastoris, insect cells .
Yield0.5–2 mg/L in E. coli; higher yields in yeast .
PurificationAffinity chromatography (His-tag), followed by reverse-phase HPLC .
ModificationsFusion with carrier proteins (e.g., GNA, CPP-1838) to enhance oral/dermal delivery .

Key Findings

  • Target Species: Effective against Drosophila suzukii, Myzus persicae, and Acyrthosiphon pisum .

  • Potency:

    SpeciesLD₅₀ (nmol/g)Delivery Method
    Drosophila suzukii3.5Injection
    Myzus persicae0.35 mg/mLOral
    Acyrthosiphon pisum0.14 mg/mLOral
  • Synergy: Co-administration with omega-hexatoxins amplifies toxicity by targeting both Kv and Cav channels .

Biotechnological Applications

  • Agricultural Biopesticides:

    • Fused with snowdrop lectin (GNA) for oral toxicity in aphids .

    • Combined with cell-penetrating peptides (CPP-1838) to enhance transdermal absorption .

  • Research Tool: Used to study ion channel physiology and insect neurobiology .

Research Gaps and Future Directions

  • Formulation Stability: Improve resistance to proteolytic degradation in pest digestive systems .

  • Field Trials: Limited data on efficacy under real-world agricultural conditions .

  • Resistance Management: Monitor potential evolutionary adaptations in target species .

Product Specs

Form
Lyophilized powder. We will ship the available format, but you can request a specific format when ordering.
Lead Time
Delivery times vary by purchase method and location. Contact your local distributor for specifics. Proteins are shipped with blue ice packs. Request dry ice in advance (extra fees apply).
Notes
Avoid repeated freezing and thawing. Working aliquots are stable at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening. Reconstitute in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer, temperature, and protein stability. Liquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us.
Synonyms
Kappa-hexatoxin-Hv1a; Kappa-HXTX-Hv1a; Janus-atracotoxin-Hv1a; Janus-AcTx-Hv1a; Kappa-atracotoxin-Hv1a; Kappa-AcTx-Hv1a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-36
Protein Length
Cytoplasmic domain
Purity
>85% (SDS-PAGE)
Species
Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)
Target Protein Sequence
TICTGADRPC AACCPCCPGT SCQGPESNGV VYCRNF
Uniprot No.

Target Background

Function
This excitatory toxin inhibits insect calcium-activated potassium (KCa) channels (Slo-type).
Protein Families
Shiva superfamily, Kappa toxin family
Subcellular Location
Secreted.
Tissue Specificity
Expressed by the venom gland.

Q&A

What is the molecular identity of κ-HXTX-Hv1a and its evolutionary relationship to other spider toxins?

κ-HXTX-Hv1a is a peptide toxin derived from the venom of the Australian funnel-web spider Hadronyche versuta. It belongs to a toxin superfamily that includes ω-HXTX-Hv1a and ω/κ-HXTX-Hv1h. Despite significant sequence divergence, these toxins maintain remarkably similar three-dimensional structures.

Evolutionary analysis reveals that κ-HXTX-Hv1a and related toxins evolved from a common ancestral gene through duplication events followed by extensive sequence divergence and neofunctionalization. This allowed the development of new pharmacological properties while preserving the core structural scaffold . RACE analysis of venom-gland cDNA libraries from multiple funnel-web spider species has confirmed that these toxins are encoded by multiple paralogous genes in a single spider rather than representing allelic variation .

The near-identical signal sequences but drastically different mature toxin regions between κ-HXTX-Hv1a and ω-HXTX-Hv1a support the theory that these toxins arose through gene duplication followed by hypermutation to create new functions. This adaptive radiation of toxin genes across Australian funnel-web spiders spans a geographic range of more than 2000 km, indicating their evolutionary importance to these spiders' predatory strategy .

How does the structure of κ-HXTX-Hv1a differ from related hexatoxins?

κ-HXTX-Hv1a shares a common inhibitor cystine knot (ICK) motif with ω-HXTX-Hv1a, but contains two additional cysteine residues that form an extremely rare vicinal disulfide bond . This structural element is absent in ω-HXTX-Hv1a and may contribute to its distinct pharmacological profile.

Despite having only 16% sequence identity (excluding the conserved cysteine framework), DaliLite structural alignment reveals that κ-HXTX-Hv1a and ω-HXTX-Hv1a have remarkably similar 3D structures, with a root mean square deviation of 2.4 Å over the backbone atoms of 28 aligned residues . The three central disulfide bridges and loop 1 align particularly well, while the major structural differences lie in the orientation of loops 2 and 3 .

The extraordinary sequence divergence despite structural conservation illustrates a key evolutionary principle: these toxins maintain a consistent molecular architecture while allowing massive variation in the inter-cystine loop sequences, enabling diverse pharmacological activities from a conserved structural template .

What are the primary molecular targets of κ-HXTX-Hv1a in insect systems?

This dual mechanism targeting both ion channels and neurotransmitter receptors likely explains the potent neuroexcitatory effects observed with these toxins. The structure-activity relationship for binding mirrors that for insecticidal activity, confirming that these molecular interactions are directly linked to the toxin's biological effects .

The hybrid toxin ω/κ-HXTX-Hv1h synergistically targets both insect voltage-gated calcium (CaV) channels and potassium channels (KCa), effectively integrating the insecticidal mechanisms of both ω-HXTX-Hv1a and κ-HXTX-Hv1c . This multitarget approach contributes to the exceptional efficacy of these toxins as insecticides.

How do the newly discovered nAChR modulatory properties reconcile with known effects on ion channels?

The discovery that κ-HXTX-Hv1a acts as a positive allosteric modulator of insect nAChRs adds a new dimension to understanding its insecticidal mechanism . This finding is consistent with the toxin's neuroexcitatory toxicology and may work synergistically with its effects on ion channels.

The dual action creates a powerful insecticidal effect: enhancement of cholinergic signaling via nAChR modulation increases neuronal excitability, while blocking KCa channels prevents normal repolarization, leading to sustained excitotoxicity. Importantly, spinosyn A, another insecticidal PAM, does not compete with hexatoxins for binding, indicating they act at different receptor populations or binding sites . This pharmacological distinction provides valuable insights for developing combination strategies in pest management.

The modulation of nAChRs by these toxins makes them particularly valuable tools for characterizing insect nAChRs and developing more selective agrochemicals with minimal cross-resistance to existing insecticides .

What expression systems are most effective for producing recombinant κ-HXTX-Hv1a?

Kluyveromyces lactis yeast expression system has been successfully used to produce recombinant hexatoxins, including related toxins like HxTx-Hv1h . This eukaryotic system facilitates proper folding and post-translational modifications of these complex disulfide-rich peptides.

When developing an expression system for κ-HXTX-Hv1a, researchers should consider:

  • Gene copy number optimization, as there is typically a positive correlation between copy number and protein expression levels up to a certain threshold .

  • Post-translational modifications, as hyperglycosylation can occur in yeast expression systems, causing the expressed proteins to migrate at higher molecular weights than predicted on SDS-PAGE .

  • Secretory expression strategies, which have been successful for related hexatoxins .

Expression and purification can be facilitated by incorporating a His-tag, enabling verification of protein identity using both anti-His and toxin-specific antibodies via Western blotting .

What challenges are commonly encountered when expressing recombinant κ-HXTX-Hv1a?

Common challenges in recombinant expression of κ-HXTX-Hv1a include:

  • Complex disulfide bond formation: The presence of the rare vicinal disulfide bond in κ-HXTX-Hv1a makes correct folding particularly challenging . Eukaryotic expression systems with appropriate oxidizing environments are essential.

  • Post-translational modifications: Expression in K. lactis can result in hyperglycosylation. For related hexatoxins, this causes proteins to migrate as broad bands within the 10-17 kDa range, exceeding their anticipated size .

  • Protein degradation: Partial degradation during expression, purification, or storage can occur, as observed for the HxTx-Hv1h/GNA fusion protein, which showed lower molecular weight bands in immunoblots with anti-HxTx-Hv1h antibodies .

  • Protein verification: Multiple verification methods are necessary to confirm successful expression. Analysis of recombinant HxTx-Hv1h required both SDS-PAGE and Western blotting with anti-His and anti-HxTx-Hv1h antibodies to confirm identity .

What methodologies are most effective for assessing the insecticidal efficacy of recombinant κ-HXTX-Hv1a?

Based on methodologies described for related toxins, optimal approaches include:

  • Contact toxicity bioassays: Immersion-based methodology adapted from Chinese laboratory bioassay standards for pesticides has been effective. This involves immersing insects (such as M. crassicauda aphids) in solutions containing the recombinant toxin at concentrations ranging from 50 μg/mL to 2000 μg/mL .

  • Comparative assessment: Including related toxins as positive controls provides valuable benchmarks. For instance, HxTx-Hv1h/GNA fusion has been used as a positive control when evaluating novel hexatoxin variants, as GNA is known to boost both oral and contact toxicity of toxic peptides .

  • Surfactant enhancement: Testing the toxin both alone and in combination with surfactants is important, as surfactants can markedly improve contact aphidicidal activity across hexatoxin variants .

  • Receptor binding assays: Characterizing binding to neuronal membranes can assess interaction with target receptors and provide insights into structure-activity relationships .

How can structure-activity relationships be established for κ-HXTX-Hv1a?

Establishing structure-activity relationships for κ-HXTX-Hv1a involves several complementary approaches:

  • Alanine scanning mutagenesis: Systematically replacing individual amino acids with alanine can identify critical functional residues. This approach has successfully elucidated the pharmacophore of related hexatoxins . For ω-HXTX-Hv1a, alanine scanning revealed a structure-activity relationship for binding that mirrors insecticidal activity .

  • Comparative structural analysis: Despite significant sequence divergence, κ-HXTX-Hv1a and ω-HXTX-Hv1a maintain similar 3D structures . Identifying structural elements unique to κ-HXTX-Hv1a (such as the vicinal disulfide bond) can highlight features critical for its specific pharmacological profile.

  • Fusion protein studies: Creating fusion proteins, such as HxTx-Hv1h/CPP-1838, can provide insights into how molecular modifications affect bioactivity. The enhanced toxicity observed when HxTx-Hv1h was fused to cell-penetrating peptide CPP-1838 demonstrates how delivery modifications can improve efficacy .

How might the hybrid properties of ω/κ-HXTX-Hv1h inform the development of novel insecticidal compounds?

ω/κ-HXTX-Hv1h (HxTx-Hv1h) represents a natural hybrid toxin that integrates the insecticidal mechanisms of both ω-HXTX-Hv1a (targeting CaV channels) and κ-HXTX-Hv1c (targeting KCa channels) . This multitarget approach creates a synergistic effect that enhances insecticidal efficacy.

The natural evolution of this hybrid toxin provides a blueprint for rational design of synthetic multitarget insecticides. Key insights include:

  • Fusion protein strategies: The success of HxTx-Hv1h/CPP-1838 demonstrates that fusing hexatoxins with cell-penetrating peptides can consistently enhance toxicity . This approach improves delivery across insect cellular membranes, increasing bioavailability.

  • Conservation of critical residues: HxTx-Hv1h shares crucial amino acid residues with both parent toxins, suggesting that certain key residues must be preserved to maintain activity against specific targets .

  • Delivery enhancement: The addition of surfactants markedly improved contact aphidicidal activity across all tested proteins, highlighting the importance of formulation in maximizing efficacy .

How does the specificity of κ-HXTX-Hv1a for insect versus vertebrate targets inform its potential as a bioinsecticide?

The specificity of κ-HXTX-Hv1a and related hexatoxins for insect targets makes them particularly valuable as potential bioinsecticides with reduced mammalian toxicity. This specificity derives from:

  • Selective receptor binding: The toxins show high affinity for insect nAChRs as positive allosteric modulators, providing a molecular basis for selective insecticidal activity .

  • Distinct ion channel targeting: κ-HXTX-Hv1a specifically blocks insect KCa channels, while ω-HXTX-Hv1a blocks insect, but not vertebrate, voltage-gated calcium (CaV) channels .

  • Unique pharmacology: These toxins represent a distinct class of nAChR PAMs with pharmacology different from existing commercial insecticides like spinosyn A, making them valuable for addressing resistance issues .

Understanding these specificity determinants can guide the rational design of toxin variants with enhanced selectivity and potency against target insect pests while maintaining a favorable safety profile for non-target organisms.

How does the mechanism of action of κ-HXTX-Hv1a compare with commercial insecticides targeting nAChRs?

κ-HXTX-Hv1a and related hexatoxins represent a unique class of insecticidal compounds with distinct advantages:

  • Multiple targets: Unlike many commercial insecticides that act on single targets, κ-HXTX-Hv1a acts on both ion channels (KCa) and neurotransmitter receptors (nAChRs) . This dual mechanism may reduce the potential for resistance development.

  • Positive allosteric modulation: While neonicotinoids act as agonists at the orthosteric site of nAChRs, hexatoxins function as positive allosteric modulators (PAMs) . This distinct binding mode offers opportunities for enhanced selectivity.

  • Non-competitive binding: Spinosyn A, another commercial PAM insecticide, does not compete with hexatoxins for binding, indicating they act at different receptor populations or binding sites . This pharmacological distinction provides valuable insights for combination strategies in resistance management.

  • Specificity profile: The toxins show selectivity for insect versus vertebrate targets, making them promising candidates for development of environmentally safer insecticides .

What techniques are most effective for distinguishing between the binding sites of κ-HXTX-Hv1a and other allosteric modulators of insect nAChRs?

To distinguish between the binding sites of κ-HXTX-Hv1a and other allosteric modulators of insect nAChRs, several techniques have proven effective:

  • Competitive binding assays: Research has shown that spinosyn A does not compete with ω-hexatoxin-Hv1a for binding, indicating they act at different receptor populations . Similar approaches can characterize κ-HXTX-Hv1a's binding site.

  • Structure-activity relationship analysis: Alanine scanning of ω-hexatoxin-Hv1a reveals a structure-activity relationship for binding that mirrors insecticidal activity . Similar analysis of κ-HXTX-Hv1a would help map its interaction surface.

  • Pharmacological profiling: The distinct pharmacology of binding between hexatoxins and spinosyn A indicates they act at different receptor populations . Characterizing the unique pharmacological fingerprint of κ-HXTX-Hv1a can differentiate its binding site from those of other modulators.

  • Receptor subtype analysis: Identifying which specific nAChR subtypes are targeted by κ-HXTX-Hv1a versus other modulators would provide crucial insights into binding site differences and could guide the development of more selective compounds.

Table 1: Comparison of Key Properties Between Hexatoxin Family Members

Propertyκ-HXTX-Hv1a (κ-HXTX-Hv1c)ω-HXTX-Hv1aω/κ-HXTX-Hv1h
Primary ion channel targetKCa channelsCaV channelsBoth KCa and CaV channels
Additional targetnAChRs (PAM)nAChRs (PAM)nAChRs (PAM)
Structural featuresICK motif + vicinal disulfide bondICK motifICK motif
Expression systemK. lactis (based on related toxins)K. lactisK. lactis
Enhancement strategiesN/AN/AFusion with CPP-1838
Evolutionary originGene duplication and neofunctionalizationGene duplication and neofunctionalizationHybrid of ω and κ toxins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.