Recombinant Haemophilus ducreyi ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Haemophilus ducreyi

Haemophilus ducreyi is a gram-negative pathogenic bacterium that causes chancroid, a genital ulcer disease known to facilitate the transmission of human immunodeficiency virus type 1 . This obligate human pathogen has no known environmental reservoirs and has evolved specific mechanisms to sense and respond to stresses imposed by the host . During infection, H. ducreyi resides in an abscess composed of neutrophils and macrophages, where it faces multiple challenges including antimicrobial peptides, hypoxic conditions, and nutrient limitation .

The genome of H. ducreyi strain 35000HP (GenBank accession no. AE017143) contains relatively few regulatory systems compared to other bacteria, with CpxRA being the only obvious intact two-component signal transduction (2CST) system identified . This limited regulatory capacity makes each protein component, including metabolic enzymes like ATP synthase, potentially critical to the organism's survival and pathogenicity.

Gene and Protein Details

The atpB gene in Haemophilus ducreyi strain 35000HP/ATCC 700724 is designated by the ordered locus name HD_0004, indicating its location near the origin of replication in the bacterial chromosome . The gene encodes the ATP synthase subunit a protein, which is also known by alternative names including "ATP synthase F0 sector subunit a" and "F-ATPase subunit 6" .

The recombinant form of H. ducreyi atpB is a full-length protein consisting of 262 amino acids (expression region 1-262) . As a recombinant protein, it may be produced with various tags to facilitate purification and detection, though the specific tag type is determined during the production process .

Table 1: Key Properties of Recombinant Haemophilus ducreyi ATP Synthase Subunit a

PropertyValue
Gene NameatpB
Locus TagHD_0004
UniProt AccessionQ7VPP6
Amino Acid Length262
Alternative NamesATP synthase F0 sector subunit a, F-ATPase subunit 6
OrganismHaemophilus ducreyi (strain 35000HP / ATCC 700724)
Commercial Quantity50 μg
Storage BufferTris-based buffer, 50% glycerol, optimized for stability

General Role in Energy Metabolism

ATP synthase represents a fundamental component of bacterial energy metabolism, serving as the primary enzyme responsible for ATP production through oxidative phosphorylation. This multi-subunit protein complex utilizes the electrochemical proton gradient established across the bacterial membrane to catalyze the synthesis of ATP from ADP and inorganic phosphate.

The ATP synthase complex consists of two main domains:

  1. The F₁ domain - contains the catalytic sites for ATP synthesis and extends into the cytoplasm

  2. The F₀ domain - forms a transmembrane channel for proton translocation and is embedded in the membrane

The atpB protein, as subunit a of the F₀ domain, plays a crucial role in forming the proton-conducting channel. This channel allows protons to flow down their concentration gradient from the periplasmic space to the cytoplasm, driving the rotation of other components of the complex and ultimately powering the conformational changes required for ATP synthesis.

Potential Role in H. ducreyi Pathogenesis

While the specific role of ATP synthase in Haemophilus ducreyi pathogenesis has not been extensively characterized in the available research, its importance can be inferred from the organism's lifestyle and requirements for survival in the human host.

As an obligate human pathogen that resides in abscesses during infection, H. ducreyi must generate sufficient energy to survive in a nutrient-limited, hypoxic environment . The ATP synthase complex, including the atpB subunit, would be essential for maintaining energy production under these challenging conditions. Furthermore, the maintenance of the proton motive force across the bacterial membrane is critical not only for ATP synthesis but also for various other cellular processes including nutrient uptake and efflux of antimicrobial compounds.

The CpxRA two-component system in H. ducreyi has been shown to regulate several virulence determinants . While no direct link between CpxRA and atpB expression has been established in the available research, it is plausible that energy metabolism through ATP synthase could interact with stress response systems to influence bacterial virulence and survival within the host.

ELISA-Based Detection and Analysis

Recombinant Haemophilus ducreyi ATP synthase subunit a is particularly formulated for application in ELISA systems . This technique allows for sensitive detection and quantification of specific targets, including proteins and antibodies. In the context of H. ducreyi research, ELISA-based applications may include:

  1. Detection of anti-atpB antibodies in patient sera for diagnostic or epidemiological studies

  2. Quantification of atpB expression under different growth conditions or in response to environmental stresses

  3. Screening for potential inhibitors that specifically target H. ducreyi ATP synthase

  4. Investigation of protein-protein interactions involving atpB

Relationship to Bacterial Pathogenesis Research

The study of ATP synthase components, including atpB, has broader implications for understanding bacterial pathogenesis. H. ducreyi utilizes specific mechanisms to adapt to the host environment and evade immune responses . The CpxRA two-component system, the only obvious intact 2CST system in the H. ducreyi genome, has been shown to regulate multiple virulence determinants .

While research specifically linking atpB to the CpxRA regulatory network is not evident in the available literature, the fundamental role of ATP synthase in bacterial energy metabolism suggests potential indirect connections. The regulation of energy production would be essential for successful adaptation to changing environmental conditions during infection.

Table 3: Regulatory Systems in H. ducreyi and Potential Relationship to ATP Synthase

Regulatory SystemKnown FunctionsPotential Relationship to ATP Synthase
CpxRARegulates virulence determinants including dsrA, lspB-lspA2 operon, and flp operon May indirectly influence energy metabolism under stress conditions
RNA-Seq defined regulonsActivation of CpxR represses nearly 70% of its targets, including seven established virulence determinants Could potentially include genes involved in energy metabolism
Growth phase dependent regulationAffects expression of virulence factors such as LspA2 May coordinate energy production with growth phase requirements

Future Research Directions

Several promising avenues exist for future research involving recombinant Haemophilus ducreyi ATP synthase subunit a:

  1. Detailed structural analysis to identify unique features compared to ATP synthase subunits from other organisms

  2. Investigation of potential post-translational modifications that might regulate activity

  3. Exploration of the effects of environmental conditions relevant to infection on atpB expression and function

  4. Development of specific inhibitors targeting H. ducreyi ATP synthase as potential therapeutic agents

  5. Examination of potential interactions between energy metabolism and known virulence mechanisms

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; HD_0004; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
atpB
Target Protein Sequence
MAVNTAEYIGHHLSFLSSGDGFWAVHLDTLFFSLVAGVLFLVVFSRVAKNATTGVPGKLQ CLVEMVVEWVDGLVKDNFHGPRHMIAPLALTIFCWVFIMNAIDLVPVDFLPQLANMFGIH YLRAVPTADISATLGMSICVFGLILFYTVKSKGFNGLAKEYTLHPFNHWAFIPVNFILET VTLLAKPISLAFRLFGNMYAGELIFILIAVMYMADNFALQALGIPLHLVWAIFHILVITL QAFIFMMLTIVYLSIAYNKADH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a crucial component of the proton channel, playing a direct role in facilitating proton translocation across the membrane.
Database Links

KEGG: hdu:HD_0004

STRING: 233412.HD0004

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does recombinant atpB compare structurally to other ATP synthase components in H. ducreyi?

While direct structural studies specifically on H. ducreyi atpB are currently limited, comparison with homologs in related organisms reveals several key features:

CharacteristicATP synthase subunit a (atpB)ATP synthase epsilon chain (atpC)
LocationMembrane-embedded (F₀ sector)Soluble component (F₁ sector)
FunctionProton channel formationRegulatory subunit; inhibits ATPase activity
Structural elementsMultiple transmembrane helicesC-terminal domain with conformational flexibility
Role in regulationStatic component of proton channelModulates between synthesis/hydrolysis modes
Recombinant expressionChallenging due to hydrophobicitySuccessfully expressed in baculovirus systems

In contrast to the epsilon subunit (atpC), which undergoes conformational changes in response to ATP binding and adopts a helical hairpin structure to stabilize the enzyme's inactive state, the atpB subunit maintains a more rigid structure as part of the membrane-embedded proton channel.

What expression systems are recommended for recombinant H. ducreyi atpB production?

Based on experience with similar membrane proteins and ATP synthase components in related organisms, the following expression systems offer distinct advantages:

  • Heterologous E. coli systems:

    • Suitable for initial expression trials

    • Requires optimization of growth temperature (typically 16-20°C)

    • May benefit from fusion partners (MBP, SUMO) to enhance solubility

    • Often requires membrane fraction isolation

  • Baculovirus expression:

    • Successfully used for other ATP synthase components including the epsilon subunit

    • Provides eukaryotic processing machinery

    • Typical expression parameters include:

      • MOI (multiplicity of infection): 2-5

      • Expression time: 48-72 hours

      • Purification via affinity tags (His₆, Strep-tag)

  • Cell-free expression systems:

    • Particularly useful for toxic or membrane proteins

    • Allows direct incorporation into nanodiscs or liposomes

    • Offers rapid screening of detergent compatibility

For membrane proteins like atpB, detergent screening is crucial, with DDM (n-dodecyl β-D-maltoside) and LMNG (lauryl maltose neopentyl glycol) showing good success with similar ATP synthase components.

How can researchers assess the functionality of recombinant H. ducreyi atpB?

Functional characterization of recombinant atpB requires multiple complementary approaches:

  • Reconstitution assays:

    • Incorporation into proteoliposomes with other ATP synthase subunits

    • Measurement of proton translocation using pH-sensitive fluorescent dyes

    • ATP synthesis measurement in the presence of artificial proton gradients

  • Complementation studies:

    • Expression of recombinant atpB in H. ducreyi atpB-deficient strains

    • Assessment of growth restoration under various metabolic conditions

    • Measurement of ATP synthesis rates in membrane vesicles

  • Proton channel activity:

    • Patch-clamp measurements of reconstituted atpB in artificial membranes

    • Hydrogen/deuterium exchange mass spectrometry to identify proton-accessible residues

    • Site-directed mutagenesis of conserved channel residues (particularly arginine residues)

Researchers should note that atpB functionality is often highly dependent on proper membrane integration and association with other ATP synthase subunits, making isolated functional studies challenging.

How does the genetic diversity of H. ducreyi strains affect atpB structure and function?

H. ducreyi strains are categorized into two distinct classes (I and II) based on genotypic and phenotypic differences . While specific atpB variations between these classes haven't been extensively documented, several insights can be drawn:

  • Conservation patterns:

    • ATP synthase components typically show high sequence conservation across bacterial species

    • Critical functional residues in proton channels are generally invariant

    • Sequence variations more commonly occur in peripheral regions away from the proton path

  • Strain classification implications:

    • Class I and II strains of H. ducreyi show significant differences in outer membrane proteins

    • DsrA protein from Class II strains shows only 48% identity to that of Class I strains

    • Similar variation may exist in membrane proteins including atpB, potentially affecting drug targeting

  • Functional adaptation:

    • Different H. ducreyi lineages may show adaptations in energy metabolism related to specific host environments

    • Variations in ATP synthase components could reflect adaptations to different pH environments or energy requirements

When designing experiments with recombinant atpB, researchers should consider using sequences from both Class I and Class II strains to account for potential functional differences.

What are the most promising approaches for targeting H. ducreyi atpB in antimicrobial development?

ATP synthase represents an emerging target for antimicrobial development, with subunit a (atpB) offering several specific advantages:

  • Structural targeting strategies:

    • High-resolution structural determination using cryo-electron microscopy

    • In silico screening against the proton channel region of atpB

    • Fragment-based drug discovery focusing on conserved regions

  • Specific inhibitor classes:

    • Diarylquinolines (similar to bedaquiline used against M. tuberculosis)

    • Phenothiazines that disrupt proton translocation

    • Peptide-based inhibitors designed to block the proton channel

  • Target validation approaches:

    • Conditional atpB mutants to demonstrate essentiality

    • Competition experiments between inhibitors and proton flow

    • Structural studies to confirm binding sites of lead compounds

The development of atpB inhibitors could potentially disrupt bacterial bioenergetics and impair H. ducreyi survival in host environments. Given that ATP synthase structure and function differs between bacteria and human mitochondria, selective toxicity may be achievable.

How does the CpxRA two-component system regulate ATP synthase components in H. ducreyi?

The CpxRA system is the only obvious intact two-component signal transduction (2CST) system in the H. ducreyi genome . Its relationship with ATP synthase involves several complex mechanisms:

  • Transcriptional regulation:

    • RNA-Seq analysis of CpxR-regulated genes in H. ducreyi revealed that activation of CpxR (by deletion of cpxA) repressed nearly 70% of its targets

    • While direct regulation of atpB wasn't specifically documented, the global metabolic impact of CpxRA activation likely affects ATP synthase expression

  • Functional evidence:

    • The cpxA deletion mutant is avirulent in humans, while the cpxR deletion mutant remains fully virulent

    • CpxA likely functions primarily as a phosphatase during infection in humans

    • This phosphatase activity may indirectly influence ATP synthase function through metabolic regulation

  • CpxR binding motif:

    • A specific CpxR binding motif was identified, enriched in downregulated targets

    • Analysis of atpB promoter regions for this motif could reveal direct regulatory links

    • Electrophoretic mobility shift assays could confirm direct binding of CpxR to ATP synthase promoters

The relationship between CpxRA and ATP synthase represents a potential node for integration of environmental sensing and energy metabolism in H. ducreyi.

What methodological approaches are most effective for studying protein-protein interactions between atpB and other ATP synthase components?

Investigating the assembly and interactions within the H. ducreyi ATP synthase complex requires sophisticated methodological approaches:

  • Cross-linking mass spectrometry (XL-MS):

    • Chemical cross-linking of assembled ATP synthase complexes

    • MS/MS analysis to identify cross-linked peptides

    • Computational modeling of interaction interfaces

    • Specific advantages: captures transient interactions; works with membrane proteins

  • Cryo-electron microscopy:

    • Single-particle analysis of purified ATP synthase complexes

    • Sub-3Å resolution structures now achievable

    • Visualization of specific conformational states

    • Identification of species-specific features relevant to drug design

  • Förster resonance energy transfer (FRET):

    • Site-specific labeling of ATP synthase subunits

    • Real-time monitoring of conformational changes during catalysis

    • Measurement of distances between specific residues

    • Application in both reconstituted systems and living cells

  • Genetic approaches:

    • Suppressor mutation analysis to identify compensatory interactions

    • Bacterial two-hybrid screening for interaction partners

    • Cysteine scanning mutagenesis combined with disulfide crosslinking

These methods together can provide comprehensive insights into how atpB interacts with other subunits to form a functional ATP synthase complex in H. ducreyi.

What are the major technical challenges in working with recombinant H. ducreyi atpB?

Researchers face several significant challenges when working with atpB:

  • Expression and purification obstacles:

    • Membrane protein solubility issues requiring extensive detergent screening

    • Tendency to form inclusion bodies in heterologous expression systems

    • Requirement for lipid reconstitution to maintain native conformation

    • Limited stability outside the complete ATP synthase complex

  • Functional characterization limitations:

    • Difficulty distinguishing atpB-specific effects from whole complex function

    • Challenges in establishing proton gradient-driven assays

    • Limited availability of H. ducreyi genetic tools for in vivo validation

    • Requirement for specialized equipment for proton transport measurements

  • Structural analysis barriers:

    • Challenges in obtaining sufficient quantities of pure, homogeneous protein

    • Conformational heterogeneity complicating structural determination

    • Technical difficulties in crystallizing membrane proteins

    • Detergent micelle interference with structural analysis

These challenges necessitate innovative approaches combining multiple complementary techniques to build a comprehensive understanding of atpB structure and function.

How might atpB function within the unique microenvironment of H. ducreyi infection sites?

H. ducreyi colonizes and establishes infection in genital ulcers, creating a distinctive microenvironment that likely influences ATP synthase function:

  • Adaptation to microaerobic conditions:

    • Genital ulcers represent a microaerobic environment

    • ATP synthase likely plays a crucial role in maintaining energy homeostasis under oxygen limitation

    • Potential shifts between respiratory and fermentative metabolism

  • Response to host immune factors:

    • H. ducreyi evades uptake by polymorphonuclear leukocyte and macrophage-like cell lines by secreting LspA1 and LspA2

    • ATP-dependent processes support secretion systems and other immune evasion mechanisms

    • Metabolic adaptation to immune-mediated stress

  • pH adaptation:

    • ATP synthase function is inherently linked to proton gradients

    • Different pH microenvironments within infection sites may modulate ATP synthase activity

    • Potential regulatory mechanisms to optimize function across pH ranges

  • Interactions with host factors:

    • H. ducreyi colocalizes with fibrin at the base of ulcers

    • ATP-dependent processes may support adhesion to host matrix proteins

    • Energy requirements for maintaining virulence factor expression

Understanding how atpB and the ATP synthase complex function within these microenvironments represents an important frontier in H. ducreyi pathogenesis research.

What is the potential for integrating structural biology with systems biology approaches to understand atpB in the context of H. ducreyi metabolism?

The integration of structural insights about atpB with systems-level understanding offers powerful new research directions:

  • Multi-scale modeling approaches:

    • Atomistic molecular dynamics simulations of proton translocation

    • Integration with metabolic flux models of H. ducreyi central metabolism

    • Prediction of system-wide effects of atpB inhibition or mutation

  • Integrative experimental strategies:

    • Correlation of ATP synthase activity with transcriptomic responses

    • Metabolomic profiling following atpB perturbation

    • Flux balance analysis with constraints derived from structural studies

  • Translational applications:

    • Virtual screening of compound libraries against structurally characterized atpB

    • Prediction of resistance mechanisms based on structural and systems models

    • Design of combination therapies targeting both ATP synthase and related metabolic pathways

  • Comparative biology opportunities:

    • Cross-species analysis of ATP synthase regulation and function

    • Identification of conserved and species-specific features relevant to therapeutic targeting

    • Evolutionary insights into adaptation of energy production systems in host environments

This integrative approach represents a frontier in understanding how fundamental bioenergetic processes contribute to H. ducreyi pathogenesis and may reveal novel intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.