Recombinant Haemophilus ducreyi Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
exbB; HD_0329; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
exbB
Target Protein Sequence
MERMLELLQGHVDYIILGILTLMSIILMWKIIERILFYKQLNVTSYETIQELEIDLTRNL TTISTIGANAPYVGLLGTVLGILLTFYHLGHSGGEIDAASIMVHLSLALKATAAGILVAI PAMMFYSGFNRKVEENKLKWQAIEVRKAKQ
Uniprot No.

Target Background

Function

ExbB is involved in TonB-dependent energy-dependent transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.

Database Links

KEGG: hdu:HD_0329

STRING: 233412.HD0329

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ExbB in the Ton system of Haemophilus ducreyi?

ExbB functions as a critical component of the Ton system in H. ducreyi, where it works in concert with ExbD and TonB to facilitate energy transduction from the cytoplasmic membrane to outer membrane receptors. Specifically, ExbB and ExbD form a proton channel complex that harvests proton motive force, which is then utilized by TonB to energize the transport of essential nutrients across the outer membrane. In H. ducreyi, this system is particularly important for hemoglobin utilization through the HgbA receptor, which has been shown to be TonB-dependent. The Ton system represents a fundamental mechanism by which gram-negative bacteria, including H. ducreyi, acquire essential nutrients such as iron from their environment .

To investigate this role experimentally, researchers typically construct isogenic mutants with deletions in the exbB gene and then evaluate the resulting phenotypic changes in nutrient acquisition. For example, studies have demonstrated that null mutations in exbB can variably affect the ability of TonB-dependent receptors to internalize or utilize their cognate ligands, with effects ranging from partial to total inhibition of ligand uptake .

How is the exbB gene organized in the H. ducreyi genome?

The exbB gene in H. ducreyi is organized in an operon with the gene arrangement of exbB-exbD-tonB. This sequential arrangement strongly suggests that these genes are transcribed as a single polycistronic mRNA, which is consistent with their functional relationship in forming the Ton system complex. The proximity and structure of these genes in H. ducreyi have been found to be most similar to those from other Pasteurellaceae family members .

For researchers interested in cloning the exbB gene, it's important to consider this operonic structure, as regulatory elements may be shared among the three genes. When designing expression systems for recombinant ExbB production, including the native promoter region can help maintain proper regulation, though care must be taken when using heterologous expression systems where regulatory mechanisms might differ.

What oligomeric states does ExbB form, and how are they regulated?

ExbB forms both hexameric and pentameric complexes with ExbD, as revealed by X-ray crystallography and cryo-EM studies. The hexameric complex consists of six ExbB subunits surrounding three ExbD transmembrane helices located within the central channel. In contrast, the pentameric complex contains five ExbB subunits with likely only one ExbD transmembrane helix .

The balance between these two oligomeric states is notably pH-dependent. Experimental evidence shows that the proportion of hexameric complexes increases with increasing pH. At pH 5.4, the ratio of pentamer to hexamer is approximately 3:1, while at pH 8.0, this ratio shifts to 1:3 in favor of the hexamer. At pH 9.0, almost all complexes adopt the hexameric form .

This pH-dependent oligomeric transition likely represents a regulatory mechanism for controlling proton channel activity and energy transduction efficiency. Researchers investigating ExbB oligomerization should carefully control pH conditions during purification and analysis to account for this dynamic equilibrium between pentameric and hexameric states.

What structural techniques have been most effective for studying ExbB complexes?

The structural analysis of ExbB complexes has been most effectively accomplished through a complementary approach combining multiple techniques, with X-ray crystallography and single-particle cryo-electron microscopy (cryo-EM) proving particularly valuable. This combined approach has been necessary because the ExbB/ExbD complex presents challenges that make it unsuitable for analysis by any single structural biology technique .

For X-ray crystallography studies, crystals of ExbB have been successfully grown in both P1 and P21 lattices, with the P21 lattice providing better data statistics and isomorphism for structure refinement. Using this approach, researchers have resolved amino acid sequences for multiple subunits in hexameric arrangements .

For cryo-EM analysis, a workflow that includes:

  • Drift correction and dose-weighting using MotionCorr2

  • CTF estimation using CTFFIND4.1

  • Automated particle picking and 2D classification

  • 3D classification through multi-class ab-initio reconstruction

  • Non-uniform refinement

  • Signal subtraction and localized refinement

This methodology has yielded maps with resolutions as high as 3.96 Å, allowing detailed structural interpretation .

Additionally, channel current measurement and 2D crystallography have provided supporting evidence for the existence and transition of different oligomeric states in membranes. The integration of these multiple techniques has been crucial for developing a comprehensive structural understanding of ExbB complexes .

How does the central channel structure differ between hexameric and pentameric ExbB complexes?

The central channel structures of hexameric and pentameric ExbB complexes exhibit significant differences that directly impact their functional capabilities:

FeatureHexameric ComplexPentameric Complex
Channel DiameterLarger (sufficient for multiple helices)Smaller (accommodates only one helix)
ExbD TM HelicesContains three ExbD TM helicesContains one ExbD TM helix
Channel LocationCentral to six ExbB subunitsCentral to five ExbB subunits
pH PreferencePredominant at higher pH (8.0-9.0)Predominant at lower pH (5.4)

The hexameric complex features a larger central channel that can accommodate multiple helices, specifically three ExbD transmembrane (TM) helices enclosed within the channel. This arrangement provides a more spacious environment that aligns with the multimerizing nature of ExbD reported in earlier studies .

In contrast, the pentameric structure has a more confined central channel that can accommodate only one helix, which has been assigned to a transmembrane segment of ExbD. This structural difference in channel capacity between the two oligomeric states suggests distinct functional roles, possibly related to different stages of the energy transduction process or responses to varying environmental conditions .

These structural differences have been confirmed through both crystal structures and cryo-EM maps, providing strong evidence for the coexistence and functional significance of both oligomeric states.

What are the key electrostatic features of the ExbB complex that contribute to its function?

The ExbB complex exhibits distinct electrostatic distributions that are critical for its function in energy transduction. Both hexameric and pentameric forms share certain electrostatic characteristics that contribute to their role in the Ton system:

The large cytoplasmic domain of ExbB contains a cluster of positively charged residues that surround the channel close to the membrane surface. This positively charged region likely interacts with negatively charged phospholipid head groups in the inner membrane and may play a role in proton translocation by creating local electrostatic fields that facilitate proton movement .

Complementing this positively charged region, there is a group of negatively charged residues located at the end of the cytoplasmic side. This arrangement creates an electrostatic gradient across the complex that may help direct the flow of protons through the channel .

The channel itself likely contains residues that can undergo protonation and deprotonation, enabling the complex to harvest proton motive force. The pH-dependent oligomeric state transition (between pentamer and hexamer) suggests that these electrostatic properties are dynamically regulated in response to local proton concentrations .

Electrostatic calculations performed using PDB2PQR and APBS have helped visualize these charge distributions . For researchers investigating the functional mechanisms of ExbB, analyzing how mutations of charged residues affect proton translocation and energy transduction would provide valuable insights into structure-function relationships.

How does the H. ducreyi Ton system differ functionally from the E. coli Ton system?

While the H. ducreyi and E. coli Ton systems share fundamental structural components (ExbB, ExbD, and TonB proteins) and the general mechanism of energy transduction, significant functional differences exist between these systems:

The H. ducreyi TonB protein shows considerable sequence divergence from E. coli TonB, particularly in the C-terminal domain. This divergence likely accounts for the inability of the H. ducreyi HgbA receptor to function effectively with the E. coli Ton system. Despite these differences, three of the four general domains previously described for E. coli TonB are present in H. ducreyi TonB, including the N-terminal hydrophobic region, the periplasmic X-Pro repeat region, and the short sequence involved in receptor interaction (YPARE in H. ducreyi versus YPARA in E. coli) .

Notably, the fourth domain of TonB (amino acids 199-216) in E. coli, which is predicted to form an alpha helix and is present in all enteric species, is so divergent in Haemophilus species that no primary sequence homology exists. This structural difference is further evidenced by the fact that monoclonal antibodies against E. coli TonB fail to react with H. ducreyi TonB .

In terms of substrate specificity, the H. ducreyi Ton system shows specialization for hemoglobin utilization through the HgbA receptor, while also maintaining a TonB-independent pathway for hemin uptake. This contrasts with some aspects of the E. coli system, which has evolved for a broader range of substrates including various siderophores .

Understanding these species-specific differences is crucial for researchers working on recombinant expression systems or when designing experiments involving heterologous expression of H. ducreyi proteins in E. coli.

What is the mechanism of pH-dependent oligomeric state transition in ExbB complexes?

The transition between pentameric and hexameric states of ExbB complexes appears to be regulated by pH, with significant implications for the functional modulation of the Ton system. The exact molecular mechanism underlying this transition involves several factors:

At lower pH (around 5.4), the pentameric form predominates (ratio of pentamer to hexamer approximately 3:1), while at higher pH (8.0 and above), the hexameric form becomes more abundant (ratio shifting to 1:3 at pH 8.0 and almost entirely hexamers at pH 9.0) .

This pH-dependent transition likely involves the protonation and deprotonation of key residues within the ExbB complex. Titratable residues such as histidines (pKa typically around 6.0), aspartic acid, and glutamic acid residues may act as pH sensors that trigger conformational changes leading to oligomeric reorganization.

The transition may relate directly to the functional role of ExbB/ExbD as a proton channel. As local pH conditions change due to proton translocation or environmental factors, the oligomeric state shifts, potentially altering channel properties, proton conductance, or interactions with TonB. This would constitute a feedback mechanism that regulates energy transduction based on the proton gradient.

For experimental investigation of this mechanism, researchers should consider:

  • Site-directed mutagenesis of potential pH-sensing residues

  • Structural analysis of the complex across a range of pH conditions

  • Functional assays that correlate proton translocation efficiency with oligomeric state

This pH-dependent oligomeric transition represents an important regulatory mechanism that allows bacteria to adjust their energy transduction systems in response to changing environmental conditions .

How does the ExbB-ExbD complex couple proton translocation to energy transfer in the Ton system?

The ExbB-ExbD complex functions as a proton channel that converts proton motive force into the energy required for active transport across the outer membrane. The molecular mechanism of this energy coupling process involves several coordinated steps:

  • Proton capture and channel formation: The ExbB-ExbD complex forms a transmembrane channel with specific residues positioned to facilitate proton translocation. The central channel formed by either the hexameric or pentameric arrangement of ExbB subunits accommodates ExbD transmembrane helices, creating a pathway for protons to move from the periplasm to the cytoplasm following the electrochemical gradient .

  • Conformational changes: Proton translocation through the channel likely induces conformational changes in both ExbB and ExbD components. These structural rearrangements are transmitted to TonB, which extends across the periplasm to interact with outer membrane receptors such as HgbA in H. ducreyi .

  • Energy transfer to TonB: The conformational energy generated by proton flow is transferred to TonB, energizing it to interact with and activate TonB-dependent receptors in the outer membrane. This activation allows the receptors to internalize their substrates (such as hemoglobin in the case of HgbA) .

The oligomeric state transition from pentamer to hexamer with increasing pH may represent different functional states of this energy coupling mechanism. The hexameric state with three ExbD transmembrane helices might provide enhanced proton conductance or more efficient energy transfer compared to the pentameric state with a single ExbD helix .

Experimental evidence for this coupling mechanism comes from studies showing that null mutations in either exbB or exbD can variably affect the ability of TonB-dependent receptors to internalize or utilize their cognate ligands, demonstrating the essential role of the ExbB-ExbD complex in energy transduction .

What reconstitution systems best preserve the native function of recombinant H. ducreyi ExbB for in vitro studies?

Establishing effective reconstitution systems for H. ducreyi ExbB requires careful consideration of multiple factors to maintain native functionality. Based on current research approaches, the following strategies are recommended:

For membrane protein extraction and purification, a detergent-based approach using mild non-ionic detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) has proven effective for ExbB complexes. These detergents help maintain protein-protein interactions within the complex while solubilizing the transmembrane domains .

When reconstituting the purified protein into artificial membrane systems, liposomes composed of E. coli polar lipid extracts or defined mixtures of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at ratios mimicking bacterial inner membranes have shown good results. For more controlled studies, nanodiscs formed with membrane scaffold proteins (MSPs) offer a defined size and lipid composition .

pH control is particularly critical given the pH-dependent oligomeric state transitions of ExbB complexes. Reconstitution buffers should be carefully chosen to maintain the desired pH, with awareness that the resulting oligomeric state distribution (pentamer vs. hexamer) will directly impact functional studies .

For functional assays, incorporating proton gradient measurements using pH-sensitive fluorescent dyes or electrical recordings of channel activity can verify that the reconstituted system maintains native transport properties. Channel current measurements have successfully been used to confirm the existence and functional properties of different oligomeric states in membrane environments .

When expressing recombinant H. ducreyi ExbB in heterologous systems such as E. coli, co-expression with ExbD from H. ducreyi is advisable to ensure proper complex formation. The functional differences between E. coli and H. ducreyi Ton system components may lead to incompatibilities when using components from different species .

How can cryo-EM methodologies be optimized for studying the dynamic transitions between different ExbB oligomeric states?

Optimizing cryo-EM methodologies for capturing the dynamic transitions between ExbB oligomeric states requires a specialized approach that addresses both technical and biological challenges:

Sample Preparation Strategies:

Time-resolved cryo-EM approaches can be implemented by initiating pH changes and then flash-freezing samples at defined time points. This would require rapid mixing devices coupled with plunge-freezing equipment to capture transition intermediates.

The use of microfluidic pH gradient devices prior to vitrification could allow visualization of the complete spectrum of oligomeric states within a single experiment, providing snapshots of the transition process across a continuous pH range.

For enhanced particle concentration and orientation diversity, graphene oxide or other support films can be employed with careful pH control of the buffer immediately before vitrification .

Data Collection and Processing Approaches:

Implement energy-filtered TEM to enhance contrast of the membrane protein complexes embedded in detergent micelles or nanodiscs.

Utilize motion correction algorithms optimized for dose-fractionated movies to maximize usable information from beam-sensitive samples, similar to the MotionCorr2 approach mentioned in the literature .

For data processing, a specialized classification workflow is essential:

  • Perform reference-free 2D classification with larger class numbers to detect subtle conformational differences

  • Use 3D variability analysis to identify concerted movements between oligomeric states

  • Implement multi-body refinement to account for flexible domains that may change during transitions

  • Apply focused classification with signal subtraction to enhance detection of subtle changes in the central channel region where ExbD transmembrane helices are located

The classification strategy should specifically account for the coexistence of pentameric and hexameric states, using approaches such as heterogeneous refinement as demonstrated in the existing research .

What are the critical residues in ExbB that determine oligomeric state preference and proton channel function?

Identifying the critical residues in ExbB that influence oligomeric state preference and proton channel function represents a frontier in understanding the molecular mechanisms of this transport system. Based on structural and functional studies, several categories of residues appear to play pivotal roles:

Interface Residues:
Amino acids located at subunit-subunit interfaces likely determine the stability of pentameric versus hexameric assemblies. In hexameric complexes, neighboring monomers of ExbB bury approximately 3000 Ų of surface area, suggesting extensive interaction surfaces . Residues at these interfaces, particularly those that form salt bridges or hydrogen bonds, would be primary targets for mutagenesis studies aiming to shift oligomeric preference.

pH-Sensing Residues:
Given the pH-dependent transition between oligomeric states, residues with pKa values in the physiologically relevant range (approximately 5-8) are likely involved in sensing proton concentration. Histidine residues are prime candidates due to their typical pKa around 6.0, though aspartate and glutamate residues could also participate in pH sensing. These residues might undergo protonation/deprotonation events that trigger conformational changes leading to oligomeric reorganization .

Channel-Lining Residues:
The central channel of ExbB complexes contains residues that directly participate in proton translocation. These would include protonatable residues arranged to form a proton relay network. The difference in channel diameter between pentameric and hexameric states suggests that different sets of residues may be exposed to the channel lumen in each state, potentially altering proton conductance properties .

ExbD-Interacting Residues:
Residues that contact the ExbD transmembrane helices are crucial for both structural assembly and function. The hexameric complex accommodates three ExbD transmembrane helices while the pentameric complex can fit only one, indicating specific interaction sites that must adapt to different stoichiometries .

For experimental investigation of these critical residues, site-directed mutagenesis coupled with functional assays measuring proton translocation efficiency and oligomeric state distribution would provide valuable insights. Additionally, molecular dynamics simulations of the different oligomeric states could help identify residues that undergo significant changes in protonation state or dynamics during the transition process.

What expression systems and purification strategies yield the highest quality recombinant H. ducreyi ExbB protein?

Optimizing expression and purification of recombinant H. ducreyi ExbB requires careful consideration of host systems, culture conditions, and purification protocols to maintain native structure and function:

Expression Systems:

  • E. coli C41(DE3) or C43(DE3): These strains, derived from BL21(DE3), are engineered for membrane protein expression and can reduce toxicity issues often encountered with membrane proteins. When using E. coli as a host for H. ducreyi ExbB, co-expression with H. ducreyi ExbD is recommended to form proper complexes .

  • PBAD/araC Induction System: Using arabinose-inducible promoters rather than T7-based systems allows for more gradual and tunable expression, which often improves membrane protein folding and reduces inclusion body formation.

  • Cell-Free Expression Systems: For difficult-to-express variants or mutants, cell-free systems supplemented with detergents or lipid nanodiscs can provide an alternative production route that bypasses toxicity issues.

Culture Conditions:

  • Temperature Optimization: Lower induction temperatures (16-20°C) significantly improve proper folding and membrane insertion of ExbB.

  • Media Supplementation: Inclusion of glycerol (0.5-1%) and specific divalent cations can enhance membrane protein expression.

  • pH Control: Given the pH-dependent oligomeric state of ExbB complexes, maintaining precise pH control during expression may influence the distribution of oligomeric states in the final preparation .

Purification Strategy:

Purification StepRecommended ApproachRationale
Membrane ExtractionDifferential centrifugation followed by sucrose gradientSeparates inner from outer membranes
SolubilizationDDM or LMNG at CMC + 0.5%Preserves native complexes
Affinity PurificationHis-tag or Strep-tag IIEnables gentle elution conditions
Size ExclusionSuperose 6 or Sephacryl S-300Separates oligomeric states
Buffer Conditions20 mM Tris/HEPES, 150 mM NaCl, 5% glycerol, 0.05% detergentStabilizes complex integrity

For structural studies such as cryo-EM, additional purification steps may include gradient centrifugation in glycerol or detergent to enhance sample homogeneity. The final buffer conditions should be carefully controlled for pH to ensure a consistent distribution of oligomeric states, particularly for comparative functional studies .

What experimental approaches can demonstrate the functional coupling between ExbB oligomeric state and TonB-dependent transport?

Demonstrating the functional relationship between ExbB oligomeric states and TonB-dependent transport requires a multi-faceted experimental approach that connects structural transitions to transport activity:

In vitro Reconstitution Assays:

  • Proton Flux Measurements: Reconstitute purified ExbB-ExbD complexes in liposomes loaded with pH-sensitive fluorescent dyes. By controlling the external pH to favor either pentameric or hexameric states, differences in proton translocation rates can be quantified. Correlation with TonB energization (measured by conformational changes in co-reconstituted TonB) would provide direct evidence of coupling efficiency differences between oligomeric states .

  • Single-Channel Electrophysiology: Using planar lipid bilayer or patch-clamp techniques, measure the channel conductance properties of pentameric versus hexameric ExbB-ExbD complexes. This approach can reveal differences in ion selectivity, gating, and voltage dependence that may explain functional differences between oligomeric states .

Genetic Approaches:

  • Engineered ExbB Variants: Design mutations that shift the equilibrium toward either pentameric or hexameric states based on structural information. Express these variants in exbB-deficient strains and measure TonB-dependent transport (e.g., 55Fe-siderophore uptake or hemoglobin utilization) to correlate oligomeric preference with transport efficiency .

  • Crosslinking Studies: Develop cysteine mutants of ExbB that allow oligomeric state-specific crosslinking in vivo. By triggering crosslinking under different pH conditions and then measuring transport activity, the functional state of each oligomer can be assessed .

Advanced Biophysical Techniques:

  • FRET-Based Conformational Sensors: Incorporate fluorescence resonance energy transfer (FRET) pairs into ExbB and TonB to monitor energy transfer during transport cycles. By manipulating pH to shift oligomeric distributions, changes in FRET efficiency can reveal how each oligomeric state couples to TonB activation.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of ExbB that undergo dynamic changes during oligomeric transitions and correlate these with functional states of the transport system.

  • Time-Resolved Cryo-EM: Capture structural intermediates during transport cycles under conditions favoring different oligomeric states to visualize the conformational coupling mechanisms .

The combination of these approaches would provide complementary evidence for how the pH-dependent oligomeric transitions of ExbB-ExbD complexes modulate the efficiency of energy transduction to TonB and ultimately to outer membrane transport processes .

How can researchers distinguish between the effects of ExbB mutations on structure versus function in the Ton system?

Distinguishing between structural and functional effects of ExbB mutations requires a systematic experimental approach that integrates structural characterization with functional assays:

Structural Assessment Strategies:

  • Oligomeric State Analysis: Utilize size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to quantify changes in the distribution of pentameric versus hexameric states. This would reveal whether mutations primarily affect oligomeric assembly .

  • Thermostability Assays: Employ differential scanning fluorimetry (DSF) or circular dichroism (CD) thermal melts to determine if mutations alter protein stability without changing gross structure.

  • Limited Proteolysis: Compare proteolytic fragmentation patterns between wild-type and mutant proteins to identify structural perturbations that expose or protect cleavage sites.

  • High-Resolution Structural Analysis: For mutations with significant functional effects, perform cryo-EM analysis to determine precise structural changes, focusing particularly on the central channel and interfaces with ExbD .

Functional Assessment Approaches:

  • Proton Translocation Assays: Measure proton transport activity in reconstituted systems using pH-sensitive dyes or electrophysiology. Compare the pH dependence of activity between wild-type and mutant proteins to identify shifts in functional properties .

  • In vivo Complementation: Introduce mutant exbB genes into exbB-deficient strains and quantify restoration of TonB-dependent nutrient acquisition (e.g., growth on hemoglobin as the sole iron source for H. ducreyi). This approach reveals the physiological relevance of structural changes .

  • ExbD and TonB Interaction Studies: Use co-immunoprecipitation or in vivo crosslinking to assess whether mutations affect the ability of ExbB to form proper complexes with ExbD and TonB without necessarily changing ExbB structure itself.

Correlation Analysis Framework:

Create a systematic matrix analysis that correlates:

  • Structural parameters (oligomeric state distribution, thermal stability, etc.)

  • Functional metrics (proton flux rates, TonB-dependent transport efficiency)

  • Physiological outcomes (bacterial growth under restrictive conditions)

For each mutation, plot these parameters to identify patterns that distinguish:

  • Mutations that primarily disrupt structure (affecting all parameters)

  • Mutations that specifically alter function while preserving structure (normal structural parameters but altered functional metrics)

  • Mutations that modify regulatory properties (shifting pH dependence or oligomeric equilibrium)

This comprehensive approach allows researchers to distinguish between mutations that:

  • Destabilize protein folding or complex assembly

  • Disrupt specific functional mechanisms such as proton translocation

  • Alter regulatory properties such as pH-dependent oligomeric transitions

  • Interfere with protein-protein interactions in the Ton system

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.