Recombinant Haemophilus ducreyi Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Haemophilus ducreyi Disulfide Bond Formation Protein B (DsbB)

Recombinant Haemophilus ducreyi Disulfide Bond Formation Protein B (DsbB) is a membrane-bound oxidoreductase critical for catalyzing disulfide bond formation in the bacterial periplasm. This protein facilitates the oxidation of periplasmic substrates, such as the dithiol oxidase DsbA, by transferring electrons to ubiquinone or menaquinone in the inner membrane . In H. ducreyi, DsbB is encoded by the dsbB gene (locus HD_1729) and shares structural and functional homology with its Escherichia coli counterpart, though specific studies on its role in H. ducreyi pathogenesis remain limited .

Comparative Analysis with Other Bacterial DsbB Proteins

DsbB homologs across bacteria exhibit conserved functional motifs but vary in substrate specificity and electron acceptors:

OrganismKey FeaturesElectron AcceptorRedox Potential (CXXC)Reference
E. coliFour TM helices, Cys41–Cys44 and Cys104–Cys130 disulfide bondsUbiquinone/menaquinone–69 mV (Cys41–Cys44)
Chlamydia trachomatisPartners with CtDsbA; role in COMC oxidationUbiquinoneNot reported
H. ducreyiFull-length recombinant protein available; structural data limitedPresumed ubiquinoneNot reported

While E. coli DsbB is extensively studied, H. ducreyi DsbB remains understudied. Its recombinant form is primarily used as a tool for biochemical assays .

Potential Roles in H. ducreyi Pathogenesis

Though not directly linked to its virulence factors (e.g., DsrA), DsbB likely supports:

  • Protein folding: Oxidation of secreted virulence proteins (e.g., adhesins, proteases).

  • Stress response: Maintenance of redox homeostasis under oxidative conditions .

Notably, H. ducreyi DsrA (a trimeric autotransporter) mediates serum resistance and ECM binding but does not share functional overlap with DsbB .

Research Gaps and Future Directions

  1. Functional Studies: No experimental data exist on H. ducreyi DsbB’s substrate specificity or redox dynamics.

  2. Pathogenicity Link: Whether DsbB contributes to H. ducreyi’s ability to resist host defenses or form biofilms remains unexplored.

  3. Structural Elucidation: Cryo-EM or X-ray crystallography studies are needed to resolve its catalytic mechanism.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery timeframe.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; HD_1729; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
dsbB
Target Protein Sequence
MLSYFKELSLRRPAWLLLATLACTLEVTGLYFQHKLGLIPCVMCIYERVALTGLLIAGLI ALIAPNFFLFRWLALVLWGFSAFKGLSLSIKHYDYQANPSPWNQCEFKPQFPQTIPLDEW FPNIFAAGTVNCSEKQWQMLGWGMPEWLIVAFSLFMLFFLIVFMSQFKRAKPQYRSVFR
Uniprot No.

Target Background

Function
Required for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: hdu:HD_1729

STRING: 233412.HD1729

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of DsbB in Haemophilus ducreyi?

DsbB in H. ducreyi, like its homologs in other prokaryotes, functions as an essential membrane protein catalyst in the disulfide bond formation pathway. It catalyzes the oxidation of the periplasmic dithiol oxidase DsbA by transferring electrons to ubiquinone in the respiratory chain . This oxidation-reduction cycle is critical for the formation of structural disulfide bonds in bacterial proteins, particularly those involved in virulence and pathogenesis . DsbB contains two catalytic disulfide bonds (Cys41-Cys44 and Cys104-Cys130 in E. coli) that participate in electron transfer during the catalytic cycle .

How does DsbB interact with DsbA in the disulfide bond formation pathway?

DsbB directly oxidizes DsbA through disulfide exchange reactions. Research on the E. coli system has shown that DsbB can oxidize one molar equivalent of DsbA in the absence of ubiquinone via disulfide exchange with the Cys104-Cys130 disulfide bond, with a rate constant of 2.7 × 10⁶ M⁻¹ s⁻¹ . This reaction occurs despite the Cys104-Cys130 disulfide being less oxidizing than the catalytic disulfide bond of DsbA (redox potentials of -186 mV and -122 mV, respectively) . The extreme oxidative force of DsbB derives from its Cys41-Cys44 disulfide, which has a remarkably high redox potential of -69 mV, making it the most oxidizing disulfide bond in a protein described to date .

What are the optimal conditions for expressing recombinant H. ducreyi DsbB?

Based on methodologies used for similar membrane proteins, recombinant expression of H. ducreyi DsbB would likely benefit from the following approach:

  • Expression system: E. coli strains lacking endogenous DsbB (ΔdsbB) are recommended to prevent functional complementation. BL21(DE3) derivatives are commonly used for membrane protein expression .

  • Expression vector: Vectors containing inducible promoters (T7 or arabinose-inducible) with fusion tags for purification (His-tag, preferably at the C-terminus to avoid interference with membrane insertion).

  • Growth conditions: Lower temperatures (16-25°C) after induction to reduce inclusion body formation, with induction at mid-log phase (OD₆₀₀ ≈ 0.6-0.8) .

  • Membrane extraction: Gentle detergent solubilization using non-ionic detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or Triton X-100 to maintain protein structure and function .

Optimization of these parameters would need to be determined empirically for H. ducreyi DsbB specifically, as membrane protein expression can be highly protein-specific.

How can the enzymatic activity of recombinant H. ducreyi DsbB be assayed?

The enzymatic activity of recombinant H. ducreyi DsbB can be assayed through several complementary approaches:

  • Ubiquinone reduction assay: Monitor the decrease in absorbance at 275 nm as ubiquinone is reduced during DsbB catalysis .

  • DsbA oxidation assay: Measure the rate of oxidation of reduced DsbA by DsbB using fluorescence-based assays that monitor the change in intrinsic tryptophan fluorescence upon DsbA oxidation .

  • Coupled enzymatic assay: Assess the ability of DsbB to restore disulfide bonds in reduced model substrates (such as insulin) via a coupled reaction with DsbA .

  • Complementation assays: Test the ability of H. ducreyi DsbB to complement E. coli dsbB mutants, which typically exhibit phenotypes such as reduced motility, increased sensitivity to dithiothreitol (DTT), and impaired disulfide bond formation in periplasmic proteins .

What purification strategies are most effective for recombinant H. ducreyi DsbB?

Purification of membrane proteins like DsbB requires specialized approaches:

  • Affinity chromatography: Utilize His-tag affinity purification with imidazole gradients for elution. Critical buffer components include:

    • Detergent: 0.05-0.1% DDM or similar mild detergent to maintain membrane protein solubility

    • Stabilizing agents: Glycerol (10-20%) to enhance protein stability

    • Reducing agents: Low concentrations of reducing agents like DTT (0.1-1 mM) during initial purification steps to protect non-catalytic cysteines

  • Size exclusion chromatography: Secondary purification to separate monomeric from aggregated protein and remove contaminants .

  • Ion exchange chromatography: Optional tertiary purification step based on the theoretical pI of H. ducreyi DsbB.

  • Quality control: Assess purity by SDS-PAGE and function through activity assays described above.

How do the catalytic mechanisms of H. ducreyi DsbB compare to E. coli DsbB?

While specific data on H. ducreyi DsbB is limited in the search results, comparative analysis with the well-characterized E. coli system would likely reveal important mechanistic insights:

E. coli DsbB contains two essential disulfide bonds (Cys41-Cys44 and Cys104-Cys130) that participate in electron transfer . The Cys41-Cys44 disulfide exhibits an unusually high redox potential (-69 mV), making it extremely oxidizing . This disulfide is specifically accessible to ubiquinone but not to DsbA . The Cys104-Cys130 disulfide interacts directly with DsbA despite having a lower redox potential (-186 mV) than DsbA's catalytic disulfide (-122 mV) .

For H. ducreyi DsbB, researchers would need to investigate:

  • Conservation of catalytic cysteine residues and their positioning

  • Redox potential measurements of the H. ducreyi DsbB disulfides

  • Kinetic analysis of electron transfer between H. ducreyi DsbB, DsbA, and ubiquinone

  • Structural studies to determine if the membrane topology and active site architecture are conserved

The rapid intramolecular disulfide exchange in partially reduced E. coli DsbB that allows reoxidation by ubiquinone should be examined in H. ducreyi DsbB to determine if this mechanism is conserved across bacterial species.

What are the implications of targeting H. ducreyi DsbB for antimicrobial development?

Targeting DsbB presents a promising strategy for antimicrobial development against H. ducreyi for several reasons:

  • Essential function: Disruption of disulfide bond formation would likely affect multiple virulence factors simultaneously.

  • Surface accessibility: As a membrane protein, certain domains of DsbB may be accessible to inhibitors.

  • Unique catalytic mechanism: The unusual redox properties of DsbB disulfides may allow for selective targeting.

Research approaches could include:

  • High-throughput screening for small molecule inhibitors that disrupt DsbB-DsbA interactions

  • Structure-based drug design targeting the ubiquinone binding site or DsbA interaction interface

  • Peptide inhibitors that mimic DsbA binding regions

Given that DsrA is a proven virulence factor in H. ducreyi and requires proper folding (potentially dependent on the Dsb system) , disrupting DsbB function could impair bacterial adhesion to host cells and extracellular matrix, potentially preventing the initiation of infection.

How does the structure-function relationship of H. ducreyi DsbB compare across bacterial homologs?

Analysis of DsbB homologs across bacterial species reveals important structure-function relationships that may be applicable to H. ducreyi DsbB:

OrganismConserved FeaturesUnique PropertiesFunctional Implications
E. coli4 transmembrane domains, 2 periplasmic loops with conserved cysteinesCys41-Cys44 in short periplasmic loop, Cys104-Cys130 in large periplasmic loopCore catalytic mechanism
H. ducreyi (predicted)Likely similar membrane topology, conserved cysteine pairsUnknown - requires experimental confirmationPotential adaptations to H. ducreyi periplasmic environment
Other Gram-negative bacteriaConservation of catalytic cysteines but variable loop regionsSpecies-specific differences in substrate specificityAdaptations to specific host environments

Researchers studying H. ducreyi DsbB should consider:

  • Sequence alignment analysis to identify conserved and divergent regions

  • Homology modeling based on available DsbB structures

  • Mutagenesis studies of predicted catalytic cysteines

  • Cross-complementation studies to assess functional conservation

What role might H. ducreyi DsbB play in antibiotic resistance mechanisms?

While the search results don't specifically address this question, several hypotheses can be proposed based on known functions of the Dsb system:

  • Stress response: DsbB may contribute to the bacterial stress response by ensuring proper folding of proteins involved in antibiotic resistance mechanisms under oxidative stress conditions.

  • Efflux pump assembly: Many antibiotic efflux pumps contain disulfide bonds that may require the Dsb system for proper folding and assembly.

  • Redox homeostasis: Disruption of DsbB function could alter periplasmic redox homeostasis, potentially affecting susceptibility to oxidative stress-inducing antibiotics.

Research methodologies to investigate these hypotheses would include:

  • Generation of conditional dsbB mutants in H. ducreyi

  • Antibiotic susceptibility testing under various redox conditions

  • Proteomic analysis of periplasmic proteins in wild-type versus dsbB-deficient strains

  • Transcriptomic analysis to identify compensatory responses to dsbB deficiency

How can challenges in expressing and purifying functional recombinant H. ducreyi DsbB be overcome?

Membrane protein expression and purification present significant challenges. For H. ducreyi DsbB, researchers may encounter:

  • Low expression levels:

    • Solution: Optimize codon usage for expression host

    • Screen multiple expression vectors and promoter strengths

    • Consider fusion partners known to enhance membrane protein expression (e.g., GFP, MBP)

  • Inclusion body formation:

    • Solution: Reduce expression temperature (16-20°C)

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Optimize induction conditions (lower inducer concentration, longer expression time)

  • Protein instability during purification:

    • Solution: Screen multiple detergents (DDM, LMNG, GDN)

    • Include stabilizing agents (glycerol, specific lipids, cholesteryl hemisuccinate)

    • Consider nanodiscs or amphipols for final purified protein

  • Loss of activity:

    • Solution: Maintain oxidizing conditions to preserve native disulfide bonds

    • Include ubiquinone analogs during purification

    • Develop rapid activity assays to monitor function throughout purification

What approaches can resolve conflicting data about DsbB function in different bacterial species?

When comparing DsbB function across bacterial species including H. ducreyi, researchers may encounter conflicting data due to:

  • Evolutionary divergence:

    • Solution: Conduct phylogenetic analysis of DsbB sequences

    • Correlate sequence variations with functional differences

    • Consider the ecological niche and host interactions of each species

  • Methodological differences:

    • Solution: Standardize experimental conditions across studies

    • Directly compare proteins using identical assays

    • Control for expression system effects on protein function

  • Context-dependent function:

    • Solution: Study DsbB in native membrane environments

    • Reconstitute with physiologically relevant interaction partners

    • Consider the impact of periplasmic pH and redox potential differences between species

A systematic approach incorporating both in vitro biochemical characterization and in vivo functional studies would help resolve conflicts and build a more comprehensive understanding of DsbB function across bacterial species, including H. ducreyi.

How can structural biology techniques be applied to elucidate H. ducreyi DsbB mechanism?

Several cutting-edge structural biology approaches could provide insights into H. ducreyi DsbB:

  • Cryo-electron microscopy (cryo-EM):

    • Suitable for membrane proteins without crystallization

    • Can potentially capture different conformational states during the catalytic cycle

    • May reveal DsbB-DsbA complexes and ubiquinone binding sites

  • X-ray crystallography:

    • Requires optimization of crystallization conditions with appropriate detergents

    • Can provide high-resolution structural data

    • Challenging but potentially highly informative

  • NMR spectroscopy:

    • Useful for studying dynamics of specific domains

    • Can provide information on conformational changes during catalysis

    • May reveal details of DsbB-DsbA interactions

  • Molecular dynamics simulations:

    • Complement experimental structures

    • Predict conformational changes during catalytic cycle

    • Model interactions with membrane environment

These approaches, combined with functional assays, would provide a comprehensive understanding of how H. ducreyi DsbB contributes to disulfide bond formation and bacterial virulence.

What potential cross-talk exists between H. ducreyi DsbB and other virulence pathways?

The interconnection between DsbB function and other virulence mechanisms in H. ducreyi represents an important area for investigation:

  • Adhesin maturation: H. ducreyi DsrA, a trimeric autotransporter adhesin and proven virulence factor, requires proper folding for function . The Dsb system likely plays a crucial role in ensuring correct disulfide bond formation in DsrA and similar adhesins.

  • Heme acquisition systems: H. ducreyi requires heme for growth and virulence. The hemoglobin receptor HgbA is essential for virulence in experimental models . The proper folding and function of HgbA and other heme acquisition proteins may depend on the Dsb system.

  • Stress response integration: DsbB function may be integrated with bacterial stress responses, potentially affecting virulence gene expression under host-associated stress conditions.

Research approaches to explore these connections could include:

  • Transcriptomic and proteomic analysis of dsbB mutants

  • Identification of proteins with altered disulfide bonding patterns in dsbB mutants

  • Investigation of virulence factor function in the presence of Dsb system inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.