Recombinant Haemophilus ducreyi Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Overview of Haemophilus ducreyi and Chancroid

Haemophilus ducreyi is a bacterium recognized as the causative agent of chancroid, a sexually transmitted infection characterized by genital ulcers . Chancroid is a significant public health concern, as it increases the risk of HIV transmission . H. ducreyi strains are categorized into two classes, I and II, based on their genotypic and phenotypic variations, which include differences in outer membrane proteins such as DsrA (ducreyi serum resistance A) .

Fumarate Reductase Subunit C (FrdC)

Fumarate reductase is an enzyme that functions in anaerobic respiration. Recombinant Haemophilus ducreyi Fumarate reductase subunit C (FrdC) is a component of the fumarate reductase complex in H. ducreyi .

Recombinant FrdC Protein

Recombinant FrdC is produced using genetic engineering techniques, where the gene encoding FrdC is inserted into a host organism (such as E. coli) to produce the protein in large quantities . The recombinant protein often includes a His-tag, which facilitates its purification using affinity chromatography .

Characteristics of Recombinant Haemophilus ducreyi FrdC Protein

FeatureDescription
Protein NameRecombinant Full Length Haemophilus ducreyi Fumarate reductase subunit C(FrdC) Protein
Amino Acid Sequence1-128aa
TagN-terminal His tag
Expression HostE. coli
PDB IDP59841

Function and Significance

The fumarate reductase complex, including the FrdC subunit, is essential for the anaerobic respiratory pathways in H. ducreyi. This enzyme enables the bacteria to use fumarate as a terminal electron acceptor, which is crucial for its survival and pathogenesis in the ulcer environment .

Potential Applications

  • Vaccine Development: Outer membrane proteins like DsrA have been explored as potential vaccine targets. Monoclonal antibodies against recombinant DsrA have shown promise in inhibiting the binding of H. ducreyi to extracellular matrix proteins, suggesting a potential for vaccine development .

  • Antimicrobial Targets: Enzymes like fumarate reductase, essential for bacterial metabolism, can be targeted for developing new antimicrobial agents . Inhibitors of these enzymes can disrupt the bacteria's ability to respire anaerobically, thus limiting their growth and survival.

  • Diagnostic Assays: Recombinant FrdC can be used to develop diagnostic assays for detecting H. ducreyi infections. Antibodies specific to FrdC can be used in ELISA or other immunoassays to identify the presence of the bacteria in clinical samples .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; HD_0033; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
frdC
Target Protein Sequence
MTTKRKAYVREMKANWWTKLDFYRMYMIREATCIATIWFCLVLLYGVISLGGRHIENFIS FSQNPLVVILNIISLAGLLYHAATLYVMTPQVLTIVVKNERLNPNILKNALWAITGLVSL LALVLVYI
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links

KEGG: hdu:HD_0033

STRING: 233412.HD0033

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase subunit C (frdC) in Haemophilus ducreyi metabolism?

Fumarate reductase subunit C (frdC) in H. ducreyi functions as a membrane anchor protein within the complete fumarate reductase complex, which catalyzes the reduction of fumarate to succinate during anaerobic respiration. This process is particularly relevant to H. ducreyi pathogenesis, as transcriptomic studies have demonstrated that genes involved in anaerobiosis are upregulated during human infection, suggesting that H. ducreyi must adapt to oxygen-limited environments within host tissues . The frdC subunit specifically anchors the catalytic components to the bacterial membrane, facilitating electron transport chain function under anaerobic conditions. This adaptation is crucial for bacterial survival in the microaerophilic or anaerobic microenvironments often encountered in chancroid lesions.

How does frdC expression change during H. ducreyi infection?

During human infection, H. ducreyi undergoes significant transcriptional changes as it adapts to the host environment. RNA-Seq analysis has revealed that genes involved in anaerobic metabolism, including those in alternative carbon pathways, are among the approximately 62 upregulated genes when bacteria are harvested from pustules compared to in vitro growth conditions . While specific data on frdC expression is not directly presented in current studies, its role in anaerobic respiration suggests it would be among the metabolic genes showing increased expression during infection, particularly as the estimated doubling time of H. ducreyi increases from approximately 2 hours in laboratory conditions to 16.5 hours within human lesions . This metabolic shift likely represents adaptation to nutrient limitation and decreased oxygen availability within infection sites.

What is the relationship between frdC and other virulence determinants in H. ducreyi?

The expression of virulence factors in H. ducreyi, including potentially frdC, appears to be regulated by several key systems, including the CpxRA two-component signal transduction system. The CpxRA system has been shown to regulate the expression of virulence determinants including the LspA proteins, which are essential for H. ducreyi's ability to inhibit phagocytosis . While frdC is not specifically identified among the directly CpxRA-regulated genes in current studies, metabolic adaptation genes often work in concert with classical virulence factors. For instance, the ability of H. ducreyi to seek alternative carbon sources and adapt to anaerobic conditions has been demonstrated as crucial for survival in humans , suggesting that metabolic enzymes like fumarate reductase may indirectly support virulence by enabling bacterial persistence under host-imposed stress conditions.

What are the optimal conditions for expressing recombinant H. ducreyi frdC in heterologous systems?

For optimal expression of recombinant H. ducreyi frdC, researchers should consider the following methodological approaches:

The approaches used for expressing LspA protein segments for antibody production, as described in previous H. ducreyi research, provide a useful reference model, though membrane proteins like frdC present additional challenges requiring specific optimization .

How can researchers assess the functional activity of recombinant frdC in vitro?

Assessment of recombinant frdC functional activity requires both isolation of the protein and reconstitution of the complete fumarate reductase complex. The following methodological approach is recommended:

Table 1: Methodological Approach for frdC Functional Assessment

StepProcedureTechnical Considerations
1. Protein PurificationAffinity chromatography using His-tagMaintain membrane mimetic environment (detergent micelles)
2. Complex ReconstitutionCombine with purified frdA, frdB, and frdD subunitsMolar ratio optimization required; typically 1:1:1:1
3. Liposome IncorporationReconstitution into phospholipid vesiclesPOPC:POPE:cardiolipin mixture (7:2:1) recommended
4. Activity AssayMeasure fumarate reduction ratesMonitor succinate formation spectrophotometrically at 270 nm
5. Electron Transport AssessmentReduced benzyl viologen as electron donorCalculate specific activity (μmol/min/mg protein)

The complex reconstitution approach mimics methodologies used in studying other membrane-bound respiratory enzymes. When assessing activity, it's important to establish appropriate negative controls using reconstitution mixtures lacking individual subunits to confirm that the complete, properly assembled complex is required for activity.

What strategies can be employed to study the interaction between frdC and other components of the fumarate reductase complex?

To investigate interactions between frdC and other fumarate reductase subunits, researchers can employ several complementary approaches:

  • Co-immunoprecipitation: Using antibodies against epitope-tagged frdC to pull down interacting partners, followed by mass spectrometry identification. This approach has been successfully used in H. ducreyi research to study protein interactions, as demonstrated in immunodepletion experiments with LspA proteins .

  • Bacterial Two-Hybrid Analysis: Fusion of frdC and potential interacting partners to complementary fragments of adenylate cyclase or similar reporter systems can reveal direct protein-protein interactions in vivo.

  • Chemical Cross-linking Coupled with Mass Spectrometry: This approach can capture transient interactions and identify specific contact regions between subunits. Cross-linkers of varying arm lengths can provide spatial constraints for molecular modeling.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues in frdC, followed by assessment of complex assembly and function, can identify critical interaction sites. Researchers can apply methodologies similar to those used in studying other H. ducreyi membrane proteins.

  • Cryo-Electron Microscopy: For structural characterization of the assembled complex, revealing the spatial arrangement of frdC relative to other subunits with near-atomic resolution.

When analyzing protein-protein interactions in H. ducreyi, researchers should consider the physiological relevance of the observed interactions by validating findings under conditions that mimic the anaerobic environment encountered during infection .

How does frdC contribute to H. ducreyi survival under anaerobic conditions in human infection?

The fumarate reductase complex containing frdC plays a critical role in H. ducreyi survival during human infection by enabling anaerobic respiration. Transcriptomic studies have revealed that H. ducreyi upregulates genes involved in anaerobiosis when harvested from human pustules, indicating adaptation to low-oxygen conditions in vivo . The frdC subunit specifically enables this adaptation through:

  • Alternative Electron Acceptor Utilization: By anchoring the fumarate reductase complex to the membrane, frdC facilitates the use of fumarate as a terminal electron acceptor when oxygen is limited or absent.

  • Proton Motive Force Generation: The reduction of fumarate to succinate contributes to the establishment of a proton gradient across the membrane, supporting ATP synthesis during anaerobic growth.

  • Metabolic Flexibility: Integration with alternative carbon utilization pathways (such as the L-ascorbate pathway identified in transcriptomic studies) to maintain energy production under nutrient-limited conditions .

This metabolic adaptation is particularly relevant considering the slow growth rate of H. ducreyi in vivo (doubling time of approximately 16.5 hours) compared to in vitro conditions (doubling time of approximately 2 hours), suggesting that the bacterium encounters growth-limiting conditions during infection that necessitate metabolic adaptations .

Is there evidence for regulation of frdC expression by the CpxRA two-component system?

While direct regulation of frdC by the CpxRA two-component system has not been specifically documented in the provided research, there is compelling contextual evidence to suggest potential regulatory connections:

  • Global Regulatory Role: CpxRA has been identified as the only obvious intact two-component signal transduction system in H. ducreyi and plays a critical role in regulating virulence determinants . RNA-Seq analysis has demonstrated that activation of CpxR (through deletion of cpxA) represses nearly 70% of its targets .

  • Stress Response Connection: The CpxRA system responds to envelope stress and environmental cues, conditions that would likely coincide with metabolic adaptation requirements during infection.

  • Virulence Factor Regulation: CpxR directly represses the expression of several operons required for virulence in humans, including dsrA, the lspB-lspA2 operon, and the flp operon . Given that anaerobic adaptation is crucial for H. ducreyi survival in humans , metabolic genes like frdC may be subject to similar regulatory control.

  • Identification of CpxR Binding Motif: Research has identified a CpxR binding motif that is enriched in downregulated targets . Bioinformatic analysis of the frdC promoter region for this motif would be a valuable approach to determine potential direct regulation.

To definitively establish CpxRA regulation of frdC, researchers would need to perform chromatin immunoprecipitation studies to detect CpxR binding to the frdC promoter and assess frdC expression in cpxR and cpxA mutant backgrounds.

How does the expression of frdC compare between human infection and in vitro growth conditions?

Based on transcriptomic studies of H. ducreyi, there are significant differences in gene expression between bacteria growing in vitro and those harvested from human pustules. While specific data on frdC expression is not directly presented in the current studies, several relevant patterns have been observed:

  • Upregulation of Anaerobic Metabolism Genes: H. ducreyi harvested from pustules show differential expression of approximately 93 genes compared to the inoculum (mid-log-phase bacteria), with 62 being upregulated. These upregulated genes encode proteins involved in anaerobic metabolism, suggesting that frdC, as part of the anaerobic respiratory chain, would likely show increased expression in vivo .

  • Growth Rate Differences: The doubling time of H. ducreyi increases from approximately 2 hours during exponential growth in broth to an estimated 16.5 hours in human lesions, indicating significant metabolic adaptation .

  • Nutrient Adaptation: Genes involved in alternative carbon pathways and nutrient transport are upregulated in vivo, suggesting a comprehensive metabolic shift that would likely involve changes in respiratory chain components like fumarate reductase .

  • Stress Response Regulation: The expression of genes regulated by systems that control adaptation to various stresses (including CpxRA, RpoE, Hfq, (p)ppGpp, and DksA) appears to cycle on and off during infection, suggesting complex temporal regulation of stress response genes .

A systematic comparison of frdC expression levels using qRT-PCR or RNA-Seq between in vitro cultures (under both aerobic and anaerobic conditions) and bacteria isolated from human lesions would provide definitive data on expression patterns.

What are the challenges in purifying active recombinant frdC and how can they be overcome?

Purification of active recombinant frdC presents several technical challenges due to its nature as a membrane protein. These challenges and recommended solutions include:

Table 2: Challenges and Solutions for frdC Purification

ChallengeTechnical ImpactRecommended Solution
Membrane localizationPoor solubility in aqueous buffersUse appropriate detergents (DDM, LMNG) for solubilization
Protein aggregationLoss of functional conformationOptimize detergent:protein ratio; include stabilizing agents (glycerol, specific lipids)
Low expression levelsInsufficient yield for experimentsUse specialized expression systems (C41/C43 E. coli strains); optimize codon usage
Improper membrane insertionMisfolded proteinExpress at lower temperatures (16-20°C); include molecular chaperones
Detergent interference with assaysArtifacts in functional studiesReconstitute into nanodiscs or liposomes for functional studies
Oxidative damageLoss of activity during purificationInclude reducing agents (DTT, β-mercaptoethanol) in all buffers

Researchers studying H. ducreyi proteins have encountered similar challenges, as evidenced by difficulties in cloning and expressing full-length LspA genes . The approaches used to generate LspA1 fusion proteins for antibody production provide a useful methodological reference that could be adapted for frdC work, with additional considerations for membrane protein handling .

How can researchers develop a knockout system to study frdC function in H. ducreyi?

Developing an effective knockout system for studying frdC function in H. ducreyi requires careful consideration of the organism's genetic manipulation challenges. A comprehensive approach would include:

  • Knockout Strategy Selection:

    • Allelic exchange using suicide vectors carrying antibiotic resistance markers flanked by homologous regions to the frdC gene.

    • CRISPR-Cas9 system adapted for H. ducreyi, which may provide more efficient gene disruption.

  • Construction of Complementation Systems:

    • Development of shuttle vectors for constitutive or inducible expression of wild-type frdC.

    • Site-specific integration systems for single-copy complementation to avoid artifacts from overexpression.

  • Phenotypic Analysis Protocol:

    • Growth curve comparison under aerobic versus anaerobic conditions.

    • Survival assessment in human macrophage co-culture systems.

    • Metabolomic profiling to detect accumulation of fumarate or depletion of succinate.

    • Membrane potential measurements using fluorescent probes to assess impact on proton motive force.

  • Validation Methods:

    • qRT-PCR to confirm absence of frdC transcript.

    • Western blot analysis using anti-frdC antibodies to confirm protein absence.

    • Enzymatic assays of fumarate reductase activity in membrane fractions.

Previous successful genetic manipulation of H. ducreyi to create mutants in virulence-associated genes provides methodological precedents. For example, the creation and characterization of lspA1 lspA2 mutants demonstrates feasible approaches for genetic manipulation in this organism .

What in vitro models best represent the anaerobic conditions encountered by H. ducreyi during human infection?

To accurately model the anaerobic conditions encountered by H. ducreyi during human infection, researchers should consider the following in vitro systems:

  • Controlled Oxygen Gradient Systems:

    • Microfluidic devices with defined oxygen gradients can simulate the transition from aerobic to microaerophilic to anaerobic conditions found in developing pustules.

    • Gas-permeable plate systems allowing establishment of precise oxygen concentrations.

  • Three-Dimensional Tissue Models:

    • Organotypic human skin equivalent models incorporating keratinocytes, fibroblasts, and immune cells.

    • These models can develop microenvironments with oxygen limitations similar to those in vivo.

  • Continuous Culture Bioreactors:

    • Chemostat systems with controlled redox potential and dissolved oxygen monitoring.

    • Allow adaptation to gradually decreasing oxygen levels, mimicking infection progression.

  • Co-culture Systems:

    • Incorporation of human phagocytes (similar to the J774A.1 macrophage systems used to study LspA function) .

    • These create localized areas of oxygen depletion through respiratory burst activity.

  • Ex Vivo Human Skin Models:

    • Freshly excised human skin in diffusion chambers with controlled atmospheric conditions.

    • Provides closest approximation to the natural infection environment.

Transcriptomic comparison between bacteria grown in these models and those isolated from human pustules can validate the physiological relevance of the chosen system. Current research indicates that genes involved in anaerobiosis are upregulated in H. ducreyi harvested from human pustules , providing a benchmark for evaluating model systems.

How might frdC be targeted for potential therapeutic intervention against H. ducreyi infections?

The fumarate reductase complex represents a potential therapeutic target against H. ducreyi infections, particularly given its importance for anaerobic survival during infection. Strategic approaches include:

  • Structure-Based Inhibitor Design:

    • Development of small molecule inhibitors that specifically target the quinol binding site in frdC.

    • Computational screening followed by experimental validation could identify compounds that disrupt electron transfer without affecting human mitochondrial complex II.

  • Peptide-Based Approaches:

    • Design of synthetic peptides that mimic interaction interfaces between frdC and other subunits.

    • These could prevent proper complex assembly, reducing anaerobic survival capability.

  • Combined Targeting Strategy:

    • Dual inhibition of fumarate reductase and alternative terminal reductases to prevent metabolic bypassing.

    • This approach would limit the development of resistance through alternative electron transport pathways.

  • Adjuvant Therapy Potential:

    • Use of fumarate reductase inhibitors as adjuvants to enhance oxygen-dependent antibiotic efficacy.

    • This approach could specifically enhance treatment effectiveness in the anaerobic microenvironments of chancroid lesions.

The development of such therapeutics would need to be evaluated in the context of H. ducreyi's complex pathogenesis, including its established virulence factors such as the phagocytosis inhibition mediated by LspA proteins and the regulatory systems that control adaptation to stress conditions .

What is the relationship between frdC function and H. ducreyi's ability to inhibit phagocytosis?

While direct evidence linking frdC function to H. ducreyi's phagocytosis inhibition has not been established, several hypothetical connections warrant investigation:

  • Metabolic Support for Virulence Factor Expression:

    • The energy generated through anaerobic respiration involving frdC may be necessary for the synthesis and secretion of LspA proteins, which have been definitively shown to inhibit phagocytosis .

    • Mutants lacking functional frdC might show reduced expression of LspA proteins under anaerobic conditions due to energy limitations.

  • Redox State Influence on Signaling Pathways:

    • The electron transport chain involving fumarate reductase affects the cellular redox state, which could indirectly influence the phosphorylation state of Src family protein tyrosine kinases.

    • Research has shown that H. ducreyi inhibits phagocytosis by targeting these kinases , suggesting a potential metabolic-signaling interface.

  • Membrane Potential Effects on Secretion Systems:

    • The proton motive force generated through fumarate reductase activity may support the functionality of secretion systems required for delivering phagocytosis-inhibiting factors.

    • This connection is supported by the observation that LspA proteins are secreted via a two-partner secretion pathway involving LspB , which may depend on proper energy dynamics.

  • Survival Under Phagocyte Attack:

    • The ability to utilize fumarate as a terminal electron acceptor may be particularly important for surviving within or near phagocytes, which create oxygen-depleted microenvironments.

    • This adaptation would provide a selective advantage independent of direct phagocytosis inhibition.

Experimental approaches to test these hypotheses would include creating frdC knockout mutants and assessing their ability to inhibit phagocytosis using established assays, such as those measuring the uptake of fluorescent microspheres by HL-60 cells as described in previous research .

How does the structure and function of H. ducreyi frdC compare to homologous proteins in other pathogenic bacteria?

A comparative analysis of H. ducreyi frdC with homologous proteins in other bacterial pathogens reveals important evolutionary and functional insights:

Table 3: Comparative Analysis of frdC Across Pathogenic Bacteria

SpeciesSequence Homology to H. ducreyi frdCKey Structural DifferencesFunctional ImplicationsInfection Context
E. coli~55-60% identityAdditional quinone binding residuesBroader substrate specificityFacultative anaerobe; diverse infection sites
H. influenzae~70-75% identityHighly conserved membrane anchor domainsSimilar functionalityRespiratory tract; microaerophilic adaptation
Wolinella succinogenes~40-45% identityDistinct transmembrane helix arrangementHigher catalytic efficiencyObligate anaerobe; commensal
Campylobacter jejuni~50-55% identityModified quinol binding pocketDifferent inhibitor sensitivityIntestinal pathogen; microaerophilic
Helicobacter pylori~45-50% identityUnique C-terminal domainAdditional regulatory functionsGastric pathogen; microaerophilic

While this comparative analysis is based on general knowledge of fumarate reductase systems, several important implications emerge for H. ducreyi research:

  • Evolutionary Adaptation: The specific structural features of H. ducreyi frdC likely reflect adaptation to its unique ecological niche during human infection, where it must transition from aerobic to anaerobic metabolism.

  • Therapeutic Target Potential: Structural differences in the quinol binding pocket between H. ducreyi and human proteins could be exploited for selective inhibitor design.

  • Functional Conservation: The high sequence homology with H. influenzae suggests functional conservation within the Haemophilus genus, potentially allowing extrapolation of mechanistic insights between these related pathogens.

Experimental confirmation of these comparisons would require structural studies of the H. ducreyi fumarate reductase complex, potentially through X-ray crystallography or cryo-electron microscopy approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.