Recombinant Haemophilus ducreyi Glycerol-3-phosphate acyltransferase (plsY)

What is the biological function of Haemophilus ducreyi Glycerol-3-phosphate acyltransferase (plsY)?

Glycerol-3-phosphate acyltransferase (plsY) in Haemophilus ducreyi is an essential enzyme that catalyzes the acylation of glycerol 3-phosphate with saturated long chain acyl-CoAs, forming lysophosphatidic acid (LPA). This reaction constitutes the first committed and rate-limiting step of glycerolipid biosynthesis in bacterial systems. The enzyme is critically involved in bacterial membrane phospholipid formation, utilizing acylphosphate as an acyl donor in the most widely distributed biosynthetic pathway for initiating phosphatidic acid formation . As part of the bacterial phospholipid synthesis pathway, plsY contributes to membrane integrity and function, making it essential for bacterial survival and potentially an attractive antimicrobial target. The enzyme's catalytic mechanism appears similar to that of serine proteases, with glycerol-3-phosphate's primary hydroxyl group functioning analogously to serine in the catalytic triad .

How does plsY differ from other acyltransferases in bacterial systems?

PlsY represents a distinct class of bacterial acyltransferases characterized by its unique donor substrate specificity and membrane topology. Unlike many acyltransferases that utilize acyl-CoA as the acyl donor, plsY specifically uses acylphosphate generated by the PlsX enzyme from acyl-acyl carrier protein (acyl-ACP) . The plsY protein contains five membrane-spanning segments with the amino terminus and two short loops positioned on the external face of the membrane, while three larger cytoplasmic domains contain the conserved sequence motifs critical for catalysis . This membrane architecture differs substantially from other acyltransferases and reflects its specialized function. Additionally, plsY's reaction represents the initial committed step in phospholipid synthesis, distinguishing it functionally from later-stage acyltransferases that modify LPA to form diverse phospholipid species. The enzyme is noncompetitively inhibited by palmitoyl-CoA, suggesting unique regulatory mechanisms not seen in other related enzymes .

What are the basic experimental considerations when working with recombinant Haemophilus ducreyi plsY?

When working with recombinant Haemophilus ducreyi plsY, researchers should consider several fundamental experimental factors to ensure optimal results:

Storage and Handling:

• Store the recombinant protein at -20°C for routine use, or at -80°C for extended storage periods

• Aliquot the protein upon receipt to avoid repeated freeze-thaw cycles that can compromise enzyme activity

• For short-term work, maintain working aliquots at 4°C for up to one week

• If using lyophilized protein, reconstitute in appropriate buffer (typically Tris/PBS-based, pH 8.0) containing 6% trehalose

Buffer Conditions:

• Optimal buffer systems typically include Tris-based buffers with 50% glycerol for stability

• Maintain pH at approximately 8.0 for maximum enzyme stability and activity

• Consider the presence of the N-terminal 10xHis tag when designing experiments, as this may influence protein behavior in certain assays

Expression Considerations:

• The recombinant protein is typically expressed in E. coli expression systems

• The full-length protein covers amino acids 1-199, with the complete sequence: "MTLTAYLLILTAYLLGSICSAIIFCRLAGLPDPRQNGSHNPGATNVLRNGGKLAAIGVLLFDTLKGSLPVLIAFRCDLSPSAIGLIGLAACLGHIFPIFFQFRGGKGVATAFGVFFSISILIASTTMICAWLIVFLLTRFSSLSAVIMALTAPFYIWCFKPEFTFPVALICCLLIYRHDNIQRLWRGQEERLWDKLKSK"

• Remember that the functional activity of recombinant plsY may be influenced by membrane environment, so consider using appropriate membrane mimetics for activity assays

What are the key conserved domains in plsY and how do they contribute to enzyme function?

The plsY enzyme contains three major conserved motifs located in cytoplasmic domains that are essential for catalytic activity. Each motif makes distinct contributions to the enzyme's function:

Motif 1:
This domain contains essential serine and arginine residues that are critical for catalytic activity. Site-directed mutagenesis studies have demonstrated that altering these residues significantly impairs enzyme function . The serine residue likely participates directly in the catalytic mechanism, potentially serving as part of the nucleophilic attack on the acylphosphate substrate. The arginine residue may contribute to substrate binding or stabilization of reaction intermediates through its positive charge.

Motif 2:
This domain exhibits characteristics of a phosphate-binding loop, functioning as the glycerol 3-phosphate binding site. When the conserved glycines in this motif are mutated to alanines, a significant Km defect for glycerol 3-phosphate binding is observed . This indicates that the structural flexibility provided by these glycine residues is essential for accommodating the phosphate group of glycerol 3-phosphate. The appropriate orientation of this substrate is critical for the subsequent acyl transfer reaction.

Motif 3:
This domain contains a conserved histidine and asparagine that are important for catalytic activity, along with a glutamate that is critical to the structural integrity of the entire plsY protein . The histidine may function in proton transfer during catalysis, while the asparagine could contribute to substrate recognition through hydrogen bonding. The glutamate appears to play a structural role that maintains the proper folding and conformation necessary for enzyme function.

The spatial arrangement of these three motifs creates the active site architecture that enables plsY to catalyze the transfer of acyl groups from acylphosphate to glycerol 3-phosphate with high specificity and efficiency.

How does the membrane topology of plsY influence its catalytic function?

The membrane topology of plsY significantly impacts its catalytic function through multiple mechanisms that optimize substrate accessibility and reaction efficiency:

Membrane Integration Pattern:
PlsY possesses five membrane-spanning segments with a distinctive arrangement where the amino terminus and two short loops are positioned on the external face of the membrane, while three larger domains containing the conserved catalytic motifs are located on the cytoplasmic side . This arrangement is functionally significant as it places the catalytic machinery in the cytoplasm where the substrates acylphosphate and glycerol 3-phosphate are predominantly located.

Substrate Channeling:
The transmembrane organization likely facilitates efficient substrate channeling between plsY and its partner enzyme plsX, which converts acyl-acyl carrier protein to acylphosphate. The proximity of these enzymes within the membrane environment may create a microenvironment that enhances reaction efficiency by limiting diffusion of the reactive acylphosphate intermediate.

Active Site Accessibility:
The cytoplasmic positioning of the three conserved catalytic domains ensures they are accessible to the water-soluble substrates while simultaneously allowing interaction with the hydrophobic membrane environment where the acyl chains will ultimately reside. This dual accessibility is crucial for the enzyme's function in generating lysophosphatidic acid, which remains membrane-associated.

Regulatory Interactions:
The membrane topology also likely influences regulatory interactions, such as the noncompetitive inhibition by palmitoyl-CoA . The positioning of regulatory sites relative to the membrane may create conformational constraints that enable specific regulatory mechanisms that would not be possible with a different topological arrangement.

Understanding this complex topology is essential for designing experiments to study plsY function and for the rational design of inhibitors targeting this enzyme for potential antimicrobial development.

What experimental approaches can be used to assess the catalytic activity of recombinant plsY?

Several experimental approaches can be employed to assess the catalytic activity of recombinant plsY, each with specific advantages and limitations:

Radiometric Assays:
The standard approach involves measuring the acylation of 14C-labelled glycerol-3-phosphate with palmitoyl-CoA initiated by adding plsY, with quantification by scintillation counting . This highly sensitive method allows precise determination of enzymatic activity under various conditions and can be used to calculate kinetic parameters such as Km and Vmax. When conducting inhibition studies, this approach enables IC50 determination by measuring activity in the presence of varying inhibitor concentrations compared to vehicle controls .

Spectrophotometric Coupled Assays:
Alternative non-radioactive methods can couple the plsY reaction to spectrophotometrically detectable reactions. For example, the release of inorganic phosphate during the reaction can be detected using colorimetric reagents such as malachite green. These assays are safer than radiometric methods but may have lower sensitivity.

Membrane Reconstitution Systems:
Since plsY is a membrane protein, reconstitution into artificial membrane systems such as liposomes or nanodiscs can provide a more native-like environment for activity assessment. This approach is particularly useful for studying how membrane composition affects enzyme activity.

Substituted Cysteine Accessibility Method:
This technique can be used to determine membrane topology and correlate structural features with catalytic function, as demonstrated in studies with Streptococcus pneumoniae PlsY . By systematically replacing amino acids with cysteines and assessing their accessibility to membrane-impermeable sulfhydryl reagents, researchers can map the protein's topology and identify regions critical for catalysis.

Site-Directed Mutagenesis:
Systematic mutation of conserved residues coupled with activity assays provides insights into the catalytic mechanism and essential amino acids. This approach has been invaluable in identifying the roles of specific residues within the three conserved motifs of plsY .

How can researchers optimize expression systems for recombinant Haemophilus ducreyi plsY?

Optimizing expression systems for recombinant Haemophilus ducreyi plsY requires careful consideration of multiple factors to ensure high yield and functional protein production:

Expression Host Selection:
While E. coli is commonly used for recombinant plsY expression , researchers should consider testing multiple strains optimized for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3). These strains are engineered to accommodate potentially toxic membrane proteins and may improve yield and solubility. For more complex studies requiring post-translational modifications, eukaryotic expression systems might be considered, though with recognition that bacterial proteins typically lack eukaryotic modifications.

Vector Design Considerations:

• Include an appropriate affinity tag (the N-terminal 10xHis-tag is commonly used for plsY) for purification

• Incorporate a protease cleavage site if tag removal is desired for functional studies

• Consider codon optimization for the expression host, particularly for rare codons present in Haemophilus ducreyi that may be limiting in E. coli

• Evaluate inducible versus constitutive promoters based on potential toxicity of overexpressed plsY

Expression Conditions Optimization:

• Test induction at various optical densities (typically mid-log phase)

• Evaluate different induction temperatures (lower temperatures of 16-25°C often improve membrane protein folding)

• Optimize inducer concentration (IPTG for T7-based systems) through small-scale expression trials

• Consider extended expression times (24-72 hours) at reduced temperatures

Membrane Protein-Specific Considerations:

• Addition of specific lipids or mild detergents to the culture medium may improve membrane insertion and folding

• Limited induction may yield better quality protein than maximum expression

• Co-expression with chaperones such as GroEL/GroES may improve folding efficiency

Purification Strategy:

• Evaluate detergent screening to identify optimal solubilization conditions that maintain function

• Consider purification in the presence of lipids or lipid-like molecules to maintain native-like environment

• Implement quality control checks at each purification step, including activity assays to ensure functional protein is being purified

Through systematic optimization of these parameters, researchers can significantly improve the quality and quantity of recombinant plsY for subsequent structural and functional studies.

What are the most effective methods for studying plsY inhibition by small molecules?

Studying plsY inhibition by small molecules requires a multi-faceted approach that leverages various experimental techniques:

In Vitro Enzyme Assays:
The primary approach involves measuring acylation of 14C-labelled glycerol-3-phosphate with palmitoyl-CoA in the presence of varying inhibitor concentrations, with subsequent scintillation counting to determine IC50 values . When implementing this method:

• Perform reactions in triplicate to ensure statistical significance

• Include appropriate vehicle controls (typically DMSO)

• Test a wide concentration range of inhibitor (typically 10nM to 100μM)

• Ensure enzyme concentration is in the linear response range

Structure-Activity Relationship (SAR) Studies:
Systematic modification of inhibitor structures reveals which chemical features are essential for activity. For plsY inhibitors, researchers have explored:

• Benzoic acids and phosphonic acids with saturated alkyl sulfonamides at various positions

• Variations in the distance between sulfonamide and carboxylate or phosphonate groups

• Alterations in the length and composition of the saturated chain that mimics the acyl-CoA substrate

Inhibition Mechanism Characterization:

• Perform kinetic studies at varying substrate and inhibitor concentrations

• Analyze data using Lineweaver-Burk, Eadie-Hofstee, or non-linear regression methods

• Determine inhibition type (competitive, noncompetitive, uncompetitive, or mixed)

• Note that plsY is noncompetitively inhibited by palmitoyl-CoA, suggesting allosteric regulation mechanisms

Computational Approaches:

• Molecular docking to predict binding modes of potential inhibitors

• Molecular dynamics simulations to understand inhibitor-enzyme interactions

• Virtual screening of compound libraries for novel inhibitor discovery

Table 1: Comparison of Methods for Evaluating plsY Inhibition

Recent studies have identified several compounds with moderate plsY inhibitory activity, particularly 2-(nonylsulfonamido)benzoic acid, which showed promising activity in intact mitochondrial assays . The design of these inhibitors focused on mimicking key features of the natural substrates, including a negative charge at physiological pH (mimicking the phosphate group) and a long saturated chain (mimicking the acyl-CoA substrate).

How can researchers investigate the membrane topology of plsY and correlate it with function?

Investigating the membrane topology of plsY and correlating it with function requires a combination of experimental approaches that provide complementary information:

Substituted Cysteine Accessibility Method (SCAM):
This powerful technique has been successfully employed to determine the membrane topology of Streptococcus pneumoniae PlsY . The method involves:

• Systematically substituting amino acids throughout the protein with cysteines

• Treating with membrane-impermeable and membrane-permeable sulfhydryl reagents

• Determining which cysteines are accessible from which side of the membrane

• Constructing a topological map based on accessibility patterns

This approach revealed that plsY possesses five membrane-spanning segments with the amino terminus and two short loops positioned on the external face of the membrane, while three larger domains containing the conserved catalytic motifs are located on the cytoplasmic side .

Site-Directed Mutagenesis Coupled with Activity Assays:
By systematically mutating residues in different predicted domains and measuring the effect on enzyme activity, researchers can:

• Identify catalytically essential residues

• Distinguish between residues involved in substrate binding versus catalysis

• Determine how topology influences substrate accessibility

Previous studies using this approach identified essential residues in three conserved motifs: serine and arginine in Motif 1, glycines in the phosphate-binding loop of Motif 2, and histidine, asparagine, and glutamate in Motif 3 .

Fluorescence-Based Approaches:

• Fluorescence resonance energy transfer (FRET) between strategically placed fluorophores can provide information about relative distances between protein domains

• Site-specific labeling with environment-sensitive fluorophores can report on local changes during substrate binding or catalysis

• GFP-fusion proteins with insertions at different positions can help map topology in live cells

Structural Biology Techniques:

• Cryo-electron microscopy of reconstituted plsY in nanodiscs or liposomes

• X-ray crystallography of detergent-solubilized or lipidic cubic phase crystallized plsY

• Solid-state NMR of isotopically labeled plsY in membrane environments

Computational Approaches:

• Molecular dynamics simulations of plsY in membrane environments can provide insights into:

  • Conformational dynamics of transmembrane segments

  • Accessibility of catalytic residues to substrates

  • Potential membrane-dependent regulatory mechanisms

• Homology modeling based on related acyltransferases can generate testable hypotheses about structure-function relationships

By integrating data from these complementary approaches, researchers can develop a comprehensive understanding of how plsY's unique membrane topology enables its specialized function in bacterial phospholipid biosynthesis.

How does plsY selectivity for acyl chain length influence bacterial membrane composition?

The selectivity of plsY for specific acyl chain lengths represents a critical regulatory mechanism that directly influences bacterial membrane composition and properties. Investigating this relationship involves several methodological approaches:

Substrate Preference Analysis:
Studies with purified plsY enzyme can determine kinetic parameters (Km, Vmax, catalytic efficiency) for acylphosphates with varying chain lengths. This requires:

• Synthesis of acylphosphates with defined chain lengths (typically C8-C20)

• Development of assays that can precisely measure reaction rates with different substrates

• Analysis of how parameters like temperature and membrane environment affect chain length preference

While studies have shown that mtGPAT1 demonstrates a strong preference for palmitoyl-CoA (C16) , the exact preferences of Haemophilus ducreyi plsY across different chain lengths require systematic investigation.

Membrane Composition Analysis:
Researchers can correlate plsY activity with membrane phospholipid profiles using:

• Lipidomic analysis by mass spectrometry to quantify phospholipids with different acyl chain compositions

• Comparison of wild-type bacteria with strains expressing modified plsY variants with altered chain length selectivity

• Integration of data on membrane physical properties (fluidity, thickness, curvature) with acyl chain distribution

Physiological Impact Assessment:
The functional consequences of altered plsY selectivity can be evaluated by examining:

• Bacterial growth under various environmental conditions (temperature, pH, osmotic stress)

• Membrane permeability to antibiotics and other compounds

• Resistance to membrane-targeting antimicrobials

Molecular Basis of Selectivity:
Understanding the structural determinants of acyl chain selectivity requires:

• Identification of the acyl chain binding pocket through mutational analysis and computational modeling

• Investigation of how membrane composition might influence the local environment of the active site

• Comparison with related acyltransferases that exhibit different chain length preferences

This research direction has significant implications for understanding bacterial adaptation to environmental conditions and potentially for developing antimicrobials that target bacteria with specific membrane compositions.

What are the challenges in developing small molecule inhibitors of plsY as potential antimicrobials?

Developing small molecule inhibitors of plsY as potential antimicrobials presents several significant challenges that researchers must address through methodical approaches:

Target Site Accessibility:
The membrane-embedded nature of plsY creates challenges for inhibitor access. The active site is positioned within the cytoplasmic domains , requiring inhibitors to cross the bacterial membrane or access the site through specific channels or interfaces. This constraint necessitates careful consideration of inhibitor physicochemical properties, including:

• Balancing hydrophilicity needed for solubility with hydrophobicity required for membrane permeation

• Optimizing molecular size and shape for movement through porin channels in Gram-negative bacteria

• Designing compounds that can evade efflux pump systems

Selectivity Challenges:
Achieving selectivity for bacterial plsY over human acyltransferases is crucial to minimize toxicity. Though the bacterial and eukaryotic enzymes differ, designing highly selective inhibitors requires:

• Detailed comparative analysis of active site architectures

• Exploitation of unique structural features in bacterial plsY

• Screening against human acyltransferases to identify and eliminate cross-reactive compounds

Rational Design Approaches:
Previous work has identified several design principles for plsY inhibitors:

• Incorporation of a negative charge at physiological pH to mimic the phosphate group of glycerol-3-phosphate

• Inclusion of a long saturated chain to mimic the acyl-CoA substrate

• Use of sulfonamide linkers as stable mimics of the presumed reaction transition state

Table 2: Challenges and Strategies in plsY Inhibitor Development

Resistance Considerations:
The potential for resistance development must be addressed through:

• Targeting highly conserved regions of plsY that cannot easily mutate without loss of function

• Developing combination approaches with other antimicrobials

• Understanding potential compensatory mechanisms that bacteria might employ

Preclinical Development Hurdles:
Promising lead compounds such as 2-(nonylsulfonamido)benzoic acid must overcome additional challenges:

• Optimization of pharmacokinetic properties

• Demonstration of efficacy in animal infection models

• Assessment of resistance frequency and mechanisms

• Evaluation of toxicity profiles

Addressing these challenges requires an integrated approach combining structural biology, medicinal chemistry, microbiology, and pharmacology to develop plsY inhibitors with realistic potential as clinical antimicrobials.

How does plsY interact with other enzymes in the bacterial phospholipid synthesis pathway?

Understanding the interactions between plsY and other enzymes in the bacterial phospholipid synthesis pathway provides critical insights into cellular metabolism regulation and potential multi-target drug development approaches. Several methodological strategies can elucidate these interactions:

Metabolic Flux Analysis:
Tracking the flow of metabolites through the phospholipid synthesis pathway using isotopically labeled precursors reveals how plsY activity affects and is affected by other enzymes. This approach can:

• Identify rate-limiting steps in the pathway

• Detect metabolic bottlenecks or overflow points

• Quantify how perturbation of plsY activity impacts flux through connected pathways

Protein-Protein Interaction Studies:
Several techniques can identify direct physical interactions between plsY and other proteins:

• Co-immunoprecipitation followed by mass spectrometry

• Bacterial two-hybrid or split-protein complementation assays

• Cross-linking studies combined with proteomic analysis

• Förster resonance energy transfer (FRET) between fluorescently labeled proteins

Particular attention should be paid to potential interactions with PlsX, which generates the acylphosphate substrate used by plsY, as these enzymes likely function in close proximity to facilitate efficient substrate channeling .

Enzyme Complex Formation:
Evidence from other metabolic pathways suggests that sequential enzymes often form functional complexes. For plsY, researchers should investigate:

• Whether plsY forms stable or transient complexes with other phospholipid synthesis enzymes

• How membrane localization influences the formation and stability of these complexes

• Whether different growth conditions alter complex formation as part of metabolic regulation

Genetic Interaction Networks:
Synthetic genetic approaches can reveal functional relationships:

• Synthetic lethal or synthetic sick interactions may indicate parallel pathways or compensatory functions

• Suppressor mutations can identify regulatory relationships

• Conditional essentiality under different growth conditions can reveal context-dependent interactions

Table 3: Key Enzyme Interactions in Bacterial Phospholipid Synthesis

Regulatory Network Analysis:
Investigating how plsY activity is coordinated with other pathway components involves:

• Transcriptomic studies to identify co-regulated genes

• Metabolomic analyses to detect allosteric regulators

• Phosphoproteomic approaches to identify post-translational modifications

• Reporter assays to monitor promoter activity under varying conditions

Understanding these complex interactions is vital not only for fundamental bacterial physiology but also for developing more sophisticated antimicrobial strategies that target vulnerable points in the phospholipid synthesis network.

What emerging technologies could advance our understanding of plsY structure and function?

Several cutting-edge technologies show promise for transforming our understanding of plsY structure, function, and potential as a therapeutic target:

Cryo-Electron Microscopy Advances:
Recent advances in cryo-EM resolution now enable structural determination of challenging membrane proteins like plsY. Key methodological approaches include:

• Single particle analysis of plsY in detergent micelles or nanodiscs

• Cryo-electron tomography of plsY in native membrane environments

• Time-resolved cryo-EM to capture different conformational states during catalysis

These approaches could reveal the first high-resolution structure of plsY, providing unprecedented insights into its catalytic mechanism and substrate binding sites.

Integrative Structural Biology:
Combining multiple structural biology techniques can overcome limitations of individual methods:

• Integrating X-ray crystallography data of soluble domains with cryo-EM of the full protein

• Using NMR spectroscopy to capture dynamic aspects of plsY function

• Complementing experimental data with molecular dynamics simulations

• Applying cross-linking mass spectrometry to map domain interactions

Advanced Microscopy Techniques:

• Super-resolution microscopy approaches like PALM, STORM, and STED can visualize plsY localization within bacterial membranes at nanometer resolution

• Single-molecule tracking can follow individual plsY molecules to understand diffusion, clustering, and interactions

• Correlative light and electron microscopy can link functional data with ultrastructural context

Artificial Intelligence Applications:

• Machine learning approaches for improved structural prediction from sequence data

• Deep learning models to predict protein-protein interactions in the phospholipid synthesis pathway

• AI-assisted design of novel plsY inhibitors based on predicted binding modes

• Automated analysis of high-throughput screening data to identify structure-activity relationships

Gene Editing and Synthetic Biology:

• CRISPR-Cas9 systems adapted for precise bacterial genome editing enable:

  • Creation of conditional mutants for in vivo functional studies

  • Introduction of site-specific mutations to test structure-function hypotheses

  • Engineering of bacteria with modified plsY to produce membranes with novel properties

• Minimal genome approaches to determine the essential interaction network of plsY

These emerging technologies, used in combination, have the potential to provide a comprehensive understanding of plsY that could lead to novel antimicrobial strategies targeting this essential bacterial enzyme.

How might environmental factors influence plsY activity and what are the implications for bacterial adaptation?

Environmental factors significantly impact plsY activity, potentially serving as key mechanisms for bacterial adaptation to changing conditions. Understanding these relationships requires sophisticated experimental approaches:

Temperature Effects on plsY Activity and Substrate Preference:
Bacteria modulate membrane fluidity in response to temperature changes, often by altering fatty acid composition. Researchers can investigate:

• How temperature affects plsY kinetics with different acyl chain substrates

• Whether temperature-dependent conformational changes alter substrate selectivity

• If plsY expression or post-translational modifications change with temperature shifts

Methodological approaches include:

• Enzyme assays at physiologically relevant temperature ranges

• Circular dichroism spectroscopy to detect conformational changes

• Differential scanning calorimetry to measure thermal stability

• Comparative analysis of membrane composition at different growth temperatures

pH Adaptation Mechanisms:
Changes in environmental pH require membrane adjustments to maintain proton gradients:

• Activity assays across pH ranges can reveal optimal conditions and adaptation potential

• Site-directed mutagenesis of pH-sensitive residues identified through computational pKa prediction

• Correlation of plsY activity with changes in membrane composition during acid/alkaline stress

Osmotic Stress Responses:
Altered osmolarity affects membrane tension and potentially plsY function:

• Comparison of plsY activity in membrane preparations from bacteria grown at different osmolarities

• Investigation of potential protein-protein interactions that change under osmotic stress

• Analysis of phospholipid headgroup composition as an adaptation to osmotic conditions

Nutrient Availability Impact:
Limited availability of acyl chain precursors may affect plsY substrate utilization:

• Metabolic labeling studies under various nutrient limitations

• Competition assays between different acyl chain substrates under rich versus poor media conditions

• Investigation of potential regulatory mechanisms linking nutrient sensing to plsY activity

Oxygen Tension Effects:
Aerobic versus anaerobic growth conditions influence membrane composition:

• Comparison of plsY activity and expression under varying oxygen conditions

• Analysis of how oxidative stress affects plsY function and membrane composition

• Investigation of potential redox-sensitive residues that might regulate enzyme activity

Understanding these adaptation mechanisms has significant implications for:

• Predicting bacterial responses to environmental stresses during infection

• Developing antimicrobials effective under specific physiological conditions

• Engineering bacteria with enhanced stress tolerance for biotechnological applications

• Understanding bacterial community dynamics in complex environments

This research direction bridges fundamental enzymology with bacterial physiology and ecology, potentially revealing new strategies for controlling bacterial growth in medical and industrial contexts.