Recombinant Haemophilus ducreyi Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; HD_2027; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
mscL
Target Protein Sequence
MSILKEFREFAVKGNVMDMAVGVIIGGAFGKIVSSLVSDVIMPPIGWLIGGVDFKDLAIQ IAPAKEGAEAVMLKYGAFIQNIFDFLIIAIAVFSMVKAINSLKRPPEVAEAPAVAKGPTQ EELLAEIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It may play a regulatory role in cellular osmotic pressure.
Database Links

KEGG: hdu:HD_2027

STRING: 233412.HD2027

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus ducreyi and what makes its MscL channel significant for research?

Haemophilus ducreyi is a Gram-negative coccobacillus that is fastidious and non-motile, primarily infecting human mucosal epithelium . It is the causative agent of chancroid, a genital ulcer disease that has notably declined globally in recent years, while simultaneously emerging as a significant cause of chronic skin ulcers, particularly among children in developing countries .

The large-conductance mechanosensitive channel (MscL) in H. ducreyi represents an important research target because mechanosensitive channels function as both sensors and effectors, responding to membrane tension by converting mechanical stimuli into cellular responses . These channels play critical roles in bacterial osmoregulation and potentially in pathogenicity. Research on H. ducreyi MscL may provide insights into:

  • Bacterial adaptation mechanisms during infection

  • Potential novel therapeutic targets

  • Evolutionary conservation of mechanosensation across species

  • Molecular basis of H. ducreyi survival in varying host environments

What techniques are commonly used to study recombinant H. ducreyi MscL?

Several complementary approaches are employed to investigate the structure, function, and dynamics of recombinant H. ducreyi MscL:

  • Electrophysiological methods: Patch clamp techniques combined with pressure stimulation provide high-resolution characterization of channel kinetics, conductance, and mechanosensitivity . Multiple configurations (cell-attached, inside-out, outside-out, and whole-cell) allow examination of single-channel or population currents.

  • Recombinant protein expression: The MscL gene can be cloned from H. ducreyi genomic DNA, expressed in heterologous systems (commonly E. coli), and purified for functional and structural studies.

  • Reconstitution in artificial membranes: Purified recombinant MscL can be incorporated into proteoliposomes with controlled lipid composition, allowing precise manipulation of membrane properties and tension .

  • Tension-response analysis: Measuring the relationship between open probability and membrane tension produces sigmoid curves (Boltzmann functions) that characterize activation thresholds and pressure sensitivity .

  • FRET-based conformational studies: Single-molecule Förster Resonance Energy Transfer enables visualization of MscL conformational changes during channel gating.

How does the H. ducreyi MscL compare structurally and functionally to better-characterized bacterial MscL channels?

While specific comparative data for H. ducreyi MscL is limited in the search results, general principles of mechanosensitive channel comparison include:

Structural comparison:

  • Most bacterial MscL channels share a pentameric structure with two transmembrane domains per subunit

  • Sequence analysis suggests H. ducreyi MscL likely maintains the core structural elements found in other bacterial homologs

  • Genome analysis of ten H. ducreyi strains identified conserved non-host homologous proteins that may include MscL

Functional comparison:

  • Channel activation typically follows a Boltzmann distribution relationship between open probability and membrane tension

  • Activation thresholds, conductance, and gating kinetics may vary between species due to adaptations to specific environmental niches

  • The unique pathogenic lifestyle of H. ducreyi may have shaped its MscL properties to function in the specialized environment of human epithelial tissues

What are the methodological challenges in expressing and characterizing recombinant H. ducreyi MscL, and how can they be addressed?

Expression challenges:

  • Bacterial culture difficulties: H. ducreyi is fastidious, requiring specialized growth conditions . For recombinant expression:

    • Consider codon-optimization for expression in E. coli or other host systems

    • Use strong inducible promoters with careful temperature control

    • Include purification tags that minimally affect channel function

  • Protein toxicity: Overexpression of membrane channels often causes toxicity to host cells.

    • Solution: Use tightly regulated expression systems and/or C41/C43 E. coli strains engineered for membrane protein expression

    • Consider inducible systems with low basal expression

  • Protein folding and membrane insertion: Ensuring proper folding in heterologous systems.

    • Include molecular chaperones in expression systems

    • Optimize membrane composition of expression hosts

Characterization challenges:

  • Functional reconstitution: Creating a native-like lipid environment.

    • Systematic testing of lipid compositions to identify optimal reconstitution conditions

    • Use of nanodiscs or liposomes with controlled curvature and tension

  • Distinguishing channel activity: Separating MscL activity from endogenous channels.

    • Expression in MscL-knockout bacterial strains

    • Use of specific inhibitors for endogenous channels

    • Introduction of signature mutations that alter conductance or mechanosensitivity

  • Applying reproducible tension: Delivering quantifiable membrane tension.

    • Standardized pressure protocols using high-precision pressure clamps

    • Correlating membrane curvature with applied pressure

How might the MscL channel contribute to H. ducreyi pathogenicity and survival during infection?

H. ducreyi shows distinctive pathogenic characteristics that may involve MscL function:

  • Osmotic stress adaptation: H. ducreyi must adapt to varying osmotic environments during infection.

    • MscL likely serves as a pressure release valve during hypoosmotic shock

    • This adaptation may be crucial for survival as H. ducreyi transitions between environments during infection

  • Immune evasion: H. ducreyi primarily evades the immune system by avoiding phagocytosis .

    • MscL may contribute to sensing membrane perturbations during immune cell interactions

    • Channel activity might trigger protective responses against membrane-active immune effectors

  • Environmental persistence: H. ducreyi has no known animal or ecological reservoir, primarily infecting human mucosal epithelium .

    • MscL could play a role in sensing and responding to mechanical forces during epithelial attachment

    • The channel may enable adaptation to mechanical stresses during ulcer formation

  • Cellular invasion process: Although H. ducreyi typically remains extracellular, MscL might:

    • Sense membrane deformation during cell-cell interactions

    • Participate in signaling cascades that regulate virulence factor expression

    • Contribute to bacterial responses to changing tissue environments

What experimental approaches can be used to investigate the structure-function relationship of H. ducreyi MscL under different tension conditions?

Experimental design table for structure-function analysis:

Tension manipulation approaches:

  • Controlled pressure application: Using calibrated pressure pulses through patch pipettes to correlate pressure with channel activity .

  • Osmotic gradient manipulation: Creating defined osmotic differentials across membranes containing reconstituted MscL.

  • Amphipathic molecule addition: Using molecules like lysophospholipids that insert into one membrane leaflet to create asymmetric tension.

  • Magnetic bead attachment: Coupling magnetic beads to specific membrane regions to apply localized forces.

  • Membrane curvature engineering: Using membranes with different radii of curvature to modulate baseline tension.

How can knockout and complementation studies be designed to investigate the physiological role of MscL in H. ducreyi?

Knockout strategy:

  • Targeted gene deletion:

    • Create a knockout construct by replacing the MscL gene with a selectable marker

    • Perform homologous recombination in H. ducreyi

    • Confirm deletion using PCR, Western blotting, and electrophysiology

    • The fastidious nature of H. ducreyi may require optimization of transformation protocols

  • CRISPR-Cas9 approach:

    • Design guide RNAs targeting the MscL gene

    • Introduce Cas9 and guide RNA on a temperature-sensitive plasmid

    • Screen for mutants with frameshifts or deletions

    • Verify knockout phenotype through multiple methods

Complementation approaches:

  • In trans complementation:

    • Reintroduce wild-type or modified MscL genes on plasmids

    • Use inducible promoters to control expression levels

    • Include epitope tags for protein detection while ensuring functionality

    • Test multiple promoter strengths to determine optimal expression levels

  • Chromosomal restoration:

    • Reintroduce the MscL gene to its native locus

    • Use counterselection approaches to remove antibiotic markers

    • Create point mutations in the chromosomal copy to test specific hypotheses

Phenotypic analyses:

  • Osmotic challenge assays:

    • Subject wild-type, knockout, and complemented strains to hypoosmotic shock

    • Measure survival rates and recovery times

    • Quantify cell morphology changes during osmotic stress

  • Infection models:

    • Compare colonization efficiency in appropriate infection models

    • Assess competitive fitness of knockout versus wild-type strains

    • Measure inflammatory responses to different strains

  • Transmission electron microscopy:

    • Examine cell envelope integrity under various stress conditions

    • Quantify morphological differences between strains

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and MscL mutants

    • Identify compensatory mechanisms that may be activated in knockout strains

What approaches can be used to investigate potential interactions between H. ducreyi MscL and host cellular components during infection?

Experimental approaches table:

TechniqueApplication to H. ducreyi MscLExpected InsightsTechnical Considerations
Protein pull-down assaysIdentify host proteins that physically interact with MscLDirect binding partnersRequires tagged recombinant MscL that maintains functionality
Yeast two-hybrid screeningScreen for interactions between MscL domains and host proteinsPotential regulatory interactionsMay yield false positives; requires verification
Co-immunoprecipitationCapture MscL with interacting host proteins from infection modelsIn vivo relevant interactionsChallenging due to membrane protein solubilization requirements
Proximity labeling (BioID/APEX)Identify proximal proteins in the infection microenvironmentSpatial organization of host-pathogen interfaceRequires genetic modification of H. ducreyi to express fusion proteins
Transcriptomic analysisCompare host response to wild-type vs. MscL-deficient H. ducreyiHost pathways affected by MscL presenceIndirect measure of interaction effects rather than physical interactions
FRET-based interaction studiesMeasure direct interactions in real-timeDynamic association kineticsTechnically challenging in infection models

Investigation of MscL in pathogenicity:

  • Mechanotransduction in infection:

    • Test how mechanical forces at the host-pathogen interface affect MscL activity

    • Investigate whether MscL senses physical contact with host cells

    • Determine if channel activity triggers virulence factor expression

  • Immune evasion mechanisms:

    • H. ducreyi avoids phagocytosis as a primary immune evasion strategy

    • Investigate whether MscL contributes to sensing immune cell contact

    • Test if MscL activity modulates surface properties that affect phagocytosis

  • Adaptation to host microenvironments:

    • H. ducreyi causes ulcerative lesions linked to mononuclear cell infiltrates

    • Study how MscL function is affected by inflammatory microenvironments

    • Test adaptation to changing osmolarity in ulcer microenvironments

How can studies of H. ducreyi MscL inform potential therapeutic strategies for tropical skin ulcers?

Given the emergence of H. ducreyi as a frequent cause of tropical skin ulcers, particularly among children in developing countries , MscL research offers several therapeutic avenues:

  • MscL as a drug target:

    • Channel-specific inhibitors could disrupt bacterial osmotic regulation

    • Small molecules targeting the channel pore or gating mechanism

    • Peptides designed to interfere with channel assembly or function

  • Mechanistic understanding for treatment optimization:

    • Current treatment involves antibiotic administration and improved hygiene

    • Understanding MscL's role could help optimize antibiotic delivery by revealing vulnerabilities

    • Combination approaches targeting both MscL and other pathways could enhance efficacy

  • Biomarker development:

    • MscL-derived peptides could serve as diagnostic biomarkers

    • Antibodies against surface-exposed regions could enable rapid testing

    • Monitoring MscL mutations might predict treatment resistance

  • Vaccine development considerations:

    • If MscL contains surface-exposed domains, these could represent vaccine targets

    • Genomic analysis of conserved non-host homologous proteins (like potential MscL regions) across H. ducreyi strains provides candidate vaccination targets

    • Table 2 from the research indicates potential vaccine targets with their properties including molecular weight, adhesin probability, and transmembrane topology

What experimental design would be optimal for comparing MscL function across multiple H. ducreyi clinical isolates?

A comprehensive experimental design would include:

  • Strain collection and genomic analysis:

    • Collect diverse clinical isolates from both genital ulcers and skin lesions

    • Sequence MscL genes to identify natural variants

    • Perform phylogenetic analysis to map evolutionary relationships

    • The genomic analysis approach used for comparing ten H. ducreyi strains could serve as a methodological template

  • Functional characterization pipeline:

    Stage 1: Expression and basic characterization

    • Clone MscL variants into standardized expression vectors

    • Express in a uniform heterologous system (E. coli knockout strain)

    • Perform patch-clamp analysis with standardized protocols

    • Measure key parameters: conductance, pressure threshold, inactivation kinetics

    Stage 2: Detailed biophysical analysis

    • Reconstitute purified channels in defined liposomes

    • Perform comparative tension sensitivity analysis

    • Measure ion selectivity and subconductance states

    • Assess lipid-dependence of channel function

    Stage 3: Structural analysis

    • Generate structural models based on sequence variations

    • Perform targeted mutagenesis to test structural predictions

    • Use spectroscopic methods to detect conformational differences

  • Correlation with clinical properties:

    • Map functional differences to clinical source (genital vs. cutaneous)

    • Correlate channel properties with virulence or persistence characteristics

    • Analyze associations between MscL variants and treatment outcomes

  • Standardized data collection and analysis:

    • Develop normalized reporting of channel parameters

    • Create a database of variant properties

    • Apply statistical approaches similar to those used in meta-analyses to identify significant patterns

How might MscL function in H. ducreyi differ from that in other bacterial pathogens, and what methodologies would best reveal these differences?

Comparative analysis framework:

  • Selection of comparison species:

    • Include both closely related Pasteurellaceae family members

    • Include well-characterized MscL-containing pathogens (E. coli, M. tuberculosis)

    • Include non-pathogenic reference species

  • Methodological approaches for comparative analysis:

    a. Sequence-structure-function correlation:

    • Align MscL sequences across selected species

    • Identify conserved regions and species-specific variations

    • Map variations to functional domains

    • Generate structural models to visualize differences

    b. Heterologous expression system:

    • Express different bacterial MscL variants in a common host

    • Standardize membrane environment and expression levels

    • Apply identical electrophysiological protocols to measure functional parameters

    • Create chimeric channels to map functional differences to specific domains

    c. Native membrane studies:

    • Extract membrane patches from different bacterial species

    • Compare native channel function in original membrane contexts

    • Analyze lipid compositions and correlate with functional differences

  • Parameters to compare:

    • Pressure activation thresholds and sensitivity (slope of Boltzmann function)

    • Conductance and ion selectivity

    • Inactivation and adaptation properties

    • Response to membrane-active antimicrobials

  • Correlation with pathogenic lifestyle:

    • Analyze how MscL properties align with infection strategies

    • Compare MscL function between genital and cutaneous H. ducreyi isolates

    • Examine adaptation to specific host tissues and infection stages

What are the critical factors for successful expression and purification of functional recombinant H. ducreyi MscL?

Key factors for expression optimization:

  • Expression system selection:

    • E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

    • Cell-free expression systems for highly toxic channels

    • Considerations for codon optimization based on H. ducreyi's AT-rich genome

  • Vector design elements:

    • Promoter strength and inducibility

    • Fusion tags: location (N vs. C-terminal) critical for function

    • Cleavage sites for tag removal

    • Signal sequences for membrane targeting

  • Growth conditions:

    • Temperature optimization (typically lower temperatures improve folding)

    • Induction timing and concentration

    • Media composition and additives that stabilize membranes

    • Growth phase at induction time

Purification strategy optimization:

  • Solubilization screening:

    • Detergent panel testing (mild vs. harsh detergents)

    • Detergent concentration optimization

    • Addition of lipids during solubilization

    • Buffer composition effects on stability

  • Purification workflow:

    • Affinity chromatography conditions

    • Secondary purification steps (size exclusion, ion exchange)

    • On-column detergent exchange options

    • Quality control checkpoints (SEC profile, SDS-PAGE, Western blot)

  • Functional validation methods:

    • Circular dichroism to confirm secondary structure

    • Reconstitution into liposomes for functional assays

    • Patch-clamp verification of mechanosensitivity

    • Thermal stability assays in different detergents

What controls and validation experiments are essential when studying recombinant H. ducreyi MscL channel activity?

Essential controls for electrophysiological studies:

  • Negative controls:

    • Empty liposomes/cells without MscL expression

    • Inactive mutant channels (e.g., gain-of-function or loss-of-function)

    • Heat-denatured protein preparations

    • Measurements in the presence of specific inhibitors

  • Positive controls:

    • Well-characterized MscL from model organisms (E. coli)

    • Known mechanosensitive channels with established properties

    • Calibrated pressure-response curves from reference channels

  • System validation:

    • Pressure calibration using reference membranes

    • Measurement of membrane capacitance to track patch area

    • Verification of seal resistance stability

    • Confirmation of consistent recording conditions

Validation experiments:

  • Structure-function confirmation:

    • Site-directed mutagenesis of conserved residues

    • Demonstration of expected conductance changes

    • Verification of characteristic subconductance states

    • Confirmation of typical pressure-response relationships

  • Reconstitution quality assessment:

    • Freeze-fracture electron microscopy to verify channel incorporation

    • Fluorescently labeled protein to quantify reconstitution efficiency

    • Liposome size and lamellarity characterization

    • Verification of membrane protein orientation

  • Specificity confirmation:

    • Pharmacological profiling with known channel modulators

    • Competition assays with unlabeled channel proteins

    • Antibody blocking experiments targeting extramembrane domains

    • Comparison with native H. ducreyi membrane patches

How can researchers address data inconsistencies when characterizing H. ducreyi MscL function across different experimental platforms?

Sources of inconsistency and mitigation strategies:

  • Expression system variations:

    • Problem: Different expression systems yield channels with varying properties

    • Solution: Standardize to a single expression system for comparative studies

    • Validation: Cross-verify key findings in multiple systems

    • Analysis: Document and account for system-specific effects

  • Membrane composition effects:

    • Problem: Lipid environment dramatically affects mechanosensitive channel function

    • Solution: Systematically test defined lipid compositions

    • Approach: Create standardized reconstitution protocols with defined lipid mixtures

    • Analysis: Include membrane composition as an explicit variable in statistical models

  • Mechanical stimulation differences:

    • Problem: Various methods of applying tension yield different results

    • Solution: Calibrate different stimulation methods against each other

    • Approach: Develop conversion factors between pressure, tension, and curvature

    • Validation: Use multiple stimulation methods on the same sample

  • Equipment-specific artifacts:

    • Problem: Different patch-clamp setups introduce systematic variations

    • Solution: Include internal standards in all experiments

    • Approach: Cross-laboratory validation of key findings

    • Analysis: Normalize to reference channels recorded on the same equipment

  • Statistical approach to reconciling data:

    • Use meta-analysis techniques similar to those described for evaluating heterogeneous data

    • Apply Bayesian methods to estimate true effect sizes amid variability

    • Explicitly model sources of heterogeneity

    • Calculate Bayes factors to evaluate the strength of evidence for competing models

  • Integrated data analysis framework:

    • Develop standardized reporting formats for channel characteristics

    • Create a centralized database of experimental conditions and results

    • Apply machine learning to identify patterns in variable datasets

    • Generate predictive models that account for experimental variables

What are the most promising future research directions for H. ducreyi MscL studies?

Several high-priority research directions emerge from current knowledge:

  • Structural biology approaches:

    • Cryo-EM structures of H. ducreyi MscL in different conformational states

    • Comparative structural analysis with other bacterial MscL channels

    • Structure-guided drug design targeting unique features

  • Systems biology integration:

    • Mapping MscL's role in the broader stress response network

    • Transcriptomic and proteomic analysis of MscL knockout effects

    • Identification of genetic and protein interaction networks

  • Pathogenesis mechanisms:

    • Investigation of MscL's contribution to H. ducreyi's transition from genital to cutaneous pathogen

    • Role in adaptation to different host microenvironments

    • Potential involvement in antibiotic resistance mechanisms

  • Therapeutic applications:

    • Development of MscL-targeted antimicrobials

    • Combination approaches with existing antibiotic regimens

    • Exploration of channel modulators as virulence inhibitors

  • Advanced imaging technologies:

    • In situ visualization of MscL dynamics during infection

    • Super-resolution microscopy of channel clustering and localization

    • Correlative microscopy linking structure to function in native environments

  • Translational research:

    • Application of findings to explain epidemiological shifts in H. ducreyi infections

    • Development of improved diagnostic approaches

    • Informing public health strategies for controlling tropical skin ulcers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.