Recombinant Haemophilus ducreyi Na (+)-translocating NADH-quinone reductase subunit C (nqrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrC; HD_0381; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
nqrC
Target Protein Sequence
MAKFNKDSVSGTLTVVVLLSLICSLIVASAAVLLKPTQDIQKQLDKQKNILQAAGLMHEN TNVQETYAKFIEPKIVDLATGDYVEDVANFDAKAFAKDPATSVAIKPEDDKANIRMRAKY AEVYLVKDEMGQTTQVVLPMYGNGLWSMMYGFVAVQPDANTVNGITYYEQGETAGLGGEI ANPNWQKSFVGKKLFNANNEVALTIGKGASADKEHGVDGLSGATLTSKGVDNSFKYWFGT NGFGPYLAKFKATAGAN
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE proteins are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: hdu:HD_0381

STRING: 233412.HD0381

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase subunit C (nqrC) and what is its role in Haemophilus ducreyi?

Na(+)-translocating NADH-quinone reductase subunit C (nqrC) is a component of the Na(+)-NQR complex, which functions as an integral membrane protein complex involved in bacterial respiration. In Haemophilus ducreyi, this complex plays a crucial role in energy metabolism by coupling NADH oxidation to sodium ion translocation across the membrane. The nqrC subunit (257 amino acids) is essential for the proper assembly and function of this respiratory complex, contributing to the organism's ability to generate energy in microaerophilic environments typically encountered during infection .

How can recombinant nqrC be expressed and purified for research purposes?

Recombinant H. ducreyi nqrC can be efficiently expressed in E. coli expression systems by following these methodological steps:

  • Gene Amplification and Cloning: The nqrC gene (UniProt ID: Q7VNU7) should be amplified from H. ducreyi genomic DNA using high-fidelity polymerase and gene-specific primers incorporating appropriate restriction sites.

  • Vector Construction: Clone the amplified gene into an expression vector containing an N-terminal His-tag sequence (e.g., pET series vectors) to facilitate purification.

  • Expression Conditions: Transform the construct into an E. coli expression strain (e.g., BL21(DE3)), culture at 37°C until mid-log phase (OD600 ~0.6), then induce protein expression with IPTG (typically 0.5-1.0 mM) at lower temperatures (16-25°C) to enhance proper folding.

  • Cell Lysis: Harvest cells by centrifugation and disrupt using sonication or pressure-based methods in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Purification: Purify the His-tagged protein using Ni-NTA affinity chromatography followed by size exclusion chromatography for higher purity.

  • Storage: Store the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and aliquot with 5-50% glycerol for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles .

What are the optimal storage conditions for maintaining nqrC protein stability and activity?

To maintain nqrC protein stability and activity, adhere to these evidence-based storage protocols:

  • Short-term Storage: For working aliquots, store at 4°C for up to one week to minimize degradation while maintaining accessibility.

  • Long-term Storage: Store lyophilized powder or concentrated protein solutions at -20°C/-80°C in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 6% trehalose as a stabilizing agent.

  • Aliquoting Strategy: Divide purified protein into single-use aliquots before freezing to avoid repeated freeze-thaw cycles that significantly reduce protein activity.

  • Reconstitution Protocol: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of glycerol (final concentration 5-50%) before aliquoting for storage.

  • Thawing Process: Thaw frozen protein samples rapidly at room temperature followed by immediate transfer to ice to minimize denaturation and activity loss .

How does nqrC interact with other subunits in the Na(+)-NQR complex, and what techniques can be used to study these interactions?

The interaction of nqrC with other Na(+)-NQR complex subunits can be studied using the following methodological approaches:

  • Co-Immunoprecipitation (Co-IP): Using antibodies against nqrC or other subunits to pull down the protein complex, followed by Western blotting or mass spectrometry to identify interacting partners.

  • Bacterial Two-Hybrid System: Modified specifically for membrane proteins to detect direct protein-protein interactions in vivo.

  • Cross-linking Studies: Using chemical cross-linkers with different spacer arm lengths to capture transient interactions, followed by mass spectrometric analysis to identify contact points.

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics between purified nqrC and other subunits when reconstituted in lipid nanodiscs.

  • FRET Analysis: Using fluorescently labeled subunits to monitor proximity and conformational changes during complex assembly.

Research has indicated that nqrC interacts directly with nqrB and nqrD subunits, forming a central core within the complex that is crucial for electron transfer and sodium pumping activities. These interactions involve both transmembrane regions and cytoplasmic domains, with specific residues in nqrC serving as anchor points for complex assembly and stability .

What role does nqrC play in H. ducreyi virulence, and how can this be investigated experimentally?

While direct evidence for nqrC's role in H. ducreyi virulence is limited in the available search results, the role can be investigated using these experimental approaches:

  • Gene Knockout Studies: Create an nqrC deletion mutant using allelic exchange methods and assess its virulence in appropriate infection models compared to wild-type strains.

  • Complementation Analysis: Restore the nqrC gene in knockout strains to confirm that observed phenotypic changes are specifically due to nqrC deficiency.

  • Transcriptional Profiling: Perform RNA-Seq analysis comparing wild-type and nqrC mutant strains at different growth phases to identify downstream effects on virulence gene expression.

  • Protein Expression Analysis: Use Western blotting to monitor expression levels of known virulence factors in nqrC mutants compared to wild-type strains.

  • Human Infection Model: Test the virulence of nqrC mutants in the human model of experimental infection, similar to studies performed with other H. ducreyi virulence determinants.

Based on related research on H. ducreyi, regulatory proteins like Hfq have been shown to control expression of multiple virulence determinants (including LspB, LspA2, DsrA, and Flp1). By analogy, disruption of energy metabolism through nqrC mutation might similarly affect virulence gene expression patterns, particularly under conditions resembling the host environment .

What are the key considerations for designing experiments to study nqrC function in sodium ion translocation?

When designing experiments to study nqrC's role in sodium translocation, researchers should consider these methodological guidelines:

  • Membrane Vesicle Preparation:

    • Prepare inside-out or right-side-out membrane vesicles from E. coli expressing recombinant Na(+)-NQR complex components

    • Ensure membrane integrity using appropriate osmotic protection during preparation

  • Ion Transport Measurement:

    • Use sodium-sensitive fluorescent dyes (e.g., SBFI) to monitor real-time Na+ movement

    • Apply radioactive 22Na+ for direct quantification of transport rates

    • Compare transport activities between wild-type and nqrC mutant proteins

  • Electrophysiological Approaches:

    • Reconstitute purified proteins in proteoliposomes or planar lipid bilayers

    • Measure ion currents using patch-clamp techniques under defined ionic conditions

    • Apply specific inhibitors to distinguish Na(+)-NQR activity from other transport systems

  • Structure-Function Analysis:

    • Create site-directed mutants targeting predicted ion-coordinating residues

    • Assess both electron transfer and ion translocation activities to distinguish these functions

    • Perform molecular dynamics simulations to predict ion translocation pathways

  • Environmental Variables Control:

    • Test function across pH ranges (6.5-8.5)

    • Vary sodium and other ion concentrations physiologically relevant to H. ducreyi infection sites

    • Examine temperature effects (25-37°C) on transport activity

How can researchers assess the impact of nqrC mutations on H. ducreyi growth and metabolism?

To comprehensively assess the impact of nqrC mutations on H. ducreyi growth and metabolism, implement the following methodological workflow:

  • Growth Curve Analysis:

    • Compare growth rates of wild-type and nqrC mutant strains in standard media

    • Assess growth under different oxygen tensions (microaerobic, anaerobic)

    • Monitor growth in sodium-limited versus sodium-rich media

  • Metabolic Profiling:

    • Measure NADH/NAD+ ratios using enzymatic or fluorescence-based assays

    • Quantify ATP production using luciferase-based assays

    • Perform metabolomics analysis to identify altered metabolic pathways

  • Respiratory Chain Activity:

    • Measure oxygen consumption rates using oxygen electrodes

    • Assess quinone reduction rates spectrophotometrically

    • Determine membrane potential using voltage-sensitive dyes

  • Stress Response Assessment:

    • Challenge strains with oxidative, nitrosative, and pH stresses

    • Compare survival rates following exposure to host defense factors

    • Monitor expression of stress response genes using qRT-PCR

  • Biofilm Formation:

    • Quantify biofilm formation using crystal violet staining

    • Visualize biofilm architecture using confocal microscopy

    • Assess microcolony formation similar to studies performed with hfq mutants

The experimental design should include appropriate controls and multiple biological replicates. Consider using complemented strains to confirm phenotypic changes are specifically due to nqrC disruption rather than polar effects on adjacent genes .

How can researchers address data contradictions in nqrC functional studies across different experimental platforms?

When encountering contradictory data in nqrC functional studies, apply this systematic framework for resolution:

  • Experimental Conditions Assessment:

    • Create a comprehensive table comparing all experimental variables across studies:

    VariableStudy AStudy BStudy CPotential Impact
    Protein constructFull-lengthTruncatedDomain-specificMay affect folding or interactions
    Expression systemE. coliNativeCell-freeInfluences post-translational modifications
    Buffer compositionHigh Na+Low Na+Buffer XDirectly impacts transport activity
    Membrane environmentNanodiscsLiposomesNativeAffects protein conformation and function
    Detection methodFluorescenceRadioisotopeElectrophysiologyVaries in sensitivity and time resolution
  • Statistical Analysis Approach:

    • Perform meta-analysis when sufficient quantitative data is available

    • Apply Bayesian statistical methods to integrate data with different confidence levels

    • Calculate effect sizes rather than relying solely on statistical significance

  • Independent Validation Protocol:

    • Design hybrid experiments incorporating methodological elements from contradictory studies

    • Use orthogonal techniques to verify key findings

    • Collaborate with laboratories reporting contradictory results

  • Biological Context Consideration:

    • Evaluate whether contradictions reflect genuine biological variability

    • Consider growth phase-dependent effects, similar to those observed with hfq regulation

    • Assess if mutations might have pleiotropic effects beyond direct nqrC function

  • Computational Modeling Integration:

    • Develop mechanistic models incorporating contradictory data points

    • Use simulation to identify experimental conditions that might reconcile contradictions

    • Apply sensitivity analysis to identify parameters most likely to explain data variability

What bioinformatic approaches can be used to predict functional domains and critical residues in nqrC?

To predict functional domains and critical residues in nqrC, implement this multi-layered bioinformatic workflow:

  • Sequence Conservation Analysis:

    • Perform multiple sequence alignment of nqrC homologs across bacterial species

    • Calculate conservation scores using methods like Jensen-Shannon divergence

    • Identify highly conserved residues as candidates for functional importance

    • Generate sequence logo plots to visualize conservation patterns

  • Domain Prediction:

    • Apply protein family (Pfam) database searching

    • Utilize SMART and InterProScan for functional domain identification

    • Implement transmembrane topology prediction using TMHMM or TOPCONS

    • Predict signal peptides using SignalP

  • Structural Modeling:

    • Generate homology models based on available crystal structures of related proteins

    • Validate models using PROCHECK, VERIFY3D, and ProSA

    • Perform molecular dynamics simulations to assess stability of predicted structures

    • Identify potential binding pockets and interfaces using CASTp or FTSite

  • Functional Site Prediction:

    • Apply machine learning approaches like ConSurf to predict functional patches

    • Use molecular docking to predict interaction with substrates and cofactors

    • Identify potential metal-binding sites using MetalDetector

    • Predict post-translational modification sites using tools like NetPhos and UbPred

  • Network Analysis:

    • Predict protein-protein interactions using STRING database

    • Perform co-evolutionary analysis to identify residues that may co-evolve with interacting partners

    • Integrate with available experimental data on NQR complex structure

This comprehensive approach would generate a prioritized list of residues for experimental validation through site-directed mutagenesis, providing a strong foundation for structure-function studies of nqrC .

How might understanding nqrC function contribute to novel antimicrobial strategies against H. ducreyi?

Understanding nqrC function could lead to novel antimicrobial strategies against H. ducreyi through these research-backed approaches:

  • Inhibitor Development Pipeline:

    • Screen for small molecules that specifically bind to nqrC using thermal shift assays

    • Design peptidomimetics targeting critical nqrC interfaces within the Na(+)-NQR complex

    • Develop transition-state analogs that interfere with nqrC's role in electron transfer

    • Test identified compounds for antimicrobial activity against H. ducreyi cultures

  • Structure-Based Drug Design Strategy:

    • Utilize structural models of nqrC to identify unique binding pockets

    • Focus on sites that differ from human host proteins to minimize toxicity

    • Design compounds that interfere with critical functional residues

    • Test compounds for species-specificity to reduce impact on commensal bacteria

  • Alternative Therapeutic Approaches:

    • Develop antisense oligonucleotides targeting nqrC mRNA

    • Design CRISPR-Cas systems for specific targeting of the nqrC gene

    • Create immunization strategies using recombinant nqrC protein or peptides

    • Investigate potential for anti-virulence approaches by modulating nqrC expression

  • Combination Therapy Research:

    • Test synergy between nqrC inhibitors and existing antibiotics

    • Explore potential for reducing antibiotic resistance through multi-target approaches

    • Investigate temporal administration strategies to maximize efficacy

  • Translational Research Considerations:

    • Establish animal models for testing nqrC-targeted therapies

    • Develop biomarkers to monitor treatment efficacy

    • Investigate potential for prophylactic applications in high-risk populations

This approach is particularly promising as research suggests Na(+)-NQR inhibition could disrupt energy metabolism in H. ducreyi, potentially affecting multiple virulence determinants simultaneously, similar to the wide-ranging effects observed with hfq gene disruption .

What are the potential implications of nqrC research for understanding bacterial bioenergetics more broadly?

Research on nqrC has significant implications for understanding bacterial bioenergetics through these conceptual frameworks:

This research direction acknowledges that fundamental understanding of bacterial bioenergetics through proteins like nqrC contributes to both basic science knowledge and potential applications across multiple fields, from medical microbiology to biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.