Recombinant Haemophilus ducreyi Na (+)-translocating NADH-quinone reductase subunit D (nqrD)

Shipped with Ice Packs
In Stock

Description

Protein Family and Nomenclature

The nqrD protein belongs to a family of Na+-translocating oxidoreductases found in various bacterial species. Within the scientific literature and commercial contexts, this protein is referred to by several synonyms including:

  • Na(+)-translocating NADH-quinone reductase subunit D

  • Na(+)-NQR subunit D

  • Na(+)-translocating NQR subunit D

  • NQR complex subunit D

  • NQR-1 subunit D

This nomenclature reflects the protein's functional role within the larger Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) complex, which typically consists of multiple subunits that work cooperatively in energy conversion processes.

Expression Systems

The recombinant form of H. ducreyi nqrD is typically expressed in Escherichia coli expression systems, which allow for efficient production of the protein in laboratory settings . This approach enables researchers to generate sufficient quantities of the protein for structural studies, functional assays, and other research applications. The recombinant protein is engineered with an N-terminal histidine tag (His-tag), which facilitates purification and detection .

Role in Energy Metabolism

The Na(+)-translocating NADH-quinone reductase complex, of which nqrD is a subunit, functions as an integral component of the bacterial respiratory chain. This complex couples the oxidation of NADH to the reduction of quinones while simultaneously translocating sodium ions across the bacterial membrane. This process contributes to the generation of a sodium motive force that can drive various cellular processes, including ATP synthesis, nutrient transport, and flagellar rotation.

While the specific function of the nqrD subunit within the complex has not been fully elucidated in the provided search results, its membrane-associated nature and sequence characteristics suggest it plays a critical role in the sodium translocation mechanism or in maintaining the structural integrity of the complex.

Membrane Association

Analysis of the amino acid sequence reveals that nqrD contains hydrophobic regions consistent with transmembrane domains, suggesting it is an integral membrane protein . This characteristic is essential for its presumed function in facilitating sodium ion movement across the bacterial membrane as part of the larger Na+-NQR complex.

Biological Context

Haemophilus ducreyi is the causative agent of chancroid, a sexually transmitted genital ulcer disease that is particularly prevalent in developing countries . This infection enhances the heterosexual transmission of human immunodeficiency virus (HIV) and can occur in focal outbreaks in the United States . Understanding the molecular components of H. ducreyi, including proteins like nqrD, may provide insights into the pathogen's metabolism and potential virulence mechanisms.

Potential Role in Pathogenesis

While the specific contribution of nqrD to H. ducreyi pathogenesis is not directly established in the provided search results, proteins involved in energy metabolism can indirectly influence virulence by affecting bacterial survival, growth, and adaptation to host environments. The Na+-NQR complex may be particularly important in environments where proton motive force generation is challenging, providing an alternative energy coupling mechanism through sodium translocation.

Research Applications

The recombinant nqrD protein can serve multiple purposes in research settings:

  1. Structural studies: The purified protein can be used for crystallography or other structural determination methods to elucidate the three-dimensional architecture of this component of the Na+-NQR complex.

  2. Functional assays: Biochemical assays can assess the protein's role in Na+ translocation and energy metabolism.

  3. Immunological studies: The protein may be used to generate antibodies or to investigate T-cell responses in the context of H. ducreyi infection.

  4. Drug discovery: As a component of bacterial energy metabolism, nqrD could potentially serve as a target for novel antimicrobial compounds.

Future Research Directions

Several promising avenues for future research on H. ducreyi nqrD include:

  1. Detailed structural analysis to determine the three-dimensional conformation and mechanism of action within the Na+-NQR complex.

  2. Investigation of potential interactions between nqrD and other subunits of the Na+-NQR complex.

  3. Assessment of the protein's potential as a diagnostic marker or vaccine candidate for chancroid.

  4. Comparative studies with nqrD proteins from other bacterial species to understand evolutionary relationships and functional conservation.

  5. Examination of the protein's potential role in adaptation to different environmental conditions, including those encountered during host infection.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrD; HD_0382; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
nqrD
Target Protein Sequence
MANNNLKKLLLSPISDNNPIALQILGICSALAVTTQLQTAFVMAIAVSLVTAFSSMFISM IRNYIPNSIRIIVQMAIIASLVILVDQILRAYVYDLSKQLSVFVGLIITNCIVMGRAEAF AMKSAPLESFVDGIGNGLGYGAMLVIVAFLRELIGSGKIFGVTVLQTIQDGGWYQANGLF LLAPSAFFIIGFVIWAIRTWKPEQVEK
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two consecutive reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, which involves the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: hdu:HD_0382

STRING: 233412.HD0382

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus ducreyi and why is it significant for research?

Haemophilus ducreyi is a fastidious, Gram-negative coccobacillus that causes chancroid, a sexually transmitted infection characterized by genital ulcer disease (GUD). This pathogen is significant for research due to its role in facilitating the acquisition and transmission of HIV. The bacterium dies rapidly outside the human host, making diagnostic testing using culture methods challenging . Though chancroid is more common in parts of Africa, Asia, and Latin America (accounting for 20% to 60% of GUD infections), it appears only sporadically in North America. The geographic distribution patterns of H. ducreyi infection remain poorly understood, creating important research opportunities to investigate transmission dynamics and pathogenesis mechanisms .

What is the Na(+)-translocating NADH-quinone reductase complex in bacteria?

The Na(+)-translocating NADH-quinone reductase (NQR) complex is an essential respiratory enzyme found in various bacteria including Haemophilus ducreyi. This enzyme complex consists of multiple subunits (including subunit D or nqrD) and functions as a primary sodium pump that couples the oxidation of NADH to the translocation of sodium ions across the bacterial membrane. The NQR complex plays a critical role in energy metabolism, establishing an electrochemical gradient that drives various cellular processes including nutrient transport, motility, and maintenance of intracellular pH. In pathogens like H. ducreyi, this complex represents a potential target for antimicrobial development due to its essential role in bacterial bioenergetics.

How does recombinant protein expression of H. ducreyi proteins typically work?

Recombinant protein expression of H. ducreyi proteins typically involves cloning the gene of interest into a suitable expression vector, followed by transformation into an appropriate host system. Based on available research with H. ducreyi proteins, successful expression often requires careful optimization of conditions. For example, in the development of a recombinant chancroid vaccine, researchers cloned the gene encoding the H. ducreyi outer membrane hemoglobin receptor HgbA into the plasmid pTETnir15 and introduced the recombinant construct into an attenuated Salmonella typhimurium SL3261 strain . Expression was induced under anaerobic conditions in vitro. This approach illustrates the importance of selecting appropriate vector systems and expression conditions for H. ducreyi proteins, which may require specific environmental triggers for optimal expression.

What are the optimal expression systems for producing recombinant H. ducreyi proteins like nqrD?

Based on prior work with H. ducreyi proteins, several expression systems have shown promise for the production of recombinant proteins from this organism. The selection of an optimal expression system depends on multiple factors including protein size, complexity, and intended application. For membrane proteins like nqrD, which is a subunit of the membrane-bound Na(+)-translocating NADH-quinone reductase complex, E. coli-based expression systems modified for membrane protein expression are often employed.

For experimental vaccine development with H. ducreyi proteins, attenuated bacterial strains like Salmonella typhimurium SL3261 have been utilized successfully . When expressing H. ducreyi proteins, researchers must consider:

  • Codon optimization for the chosen expression host

  • Inclusion of appropriate purification tags (His-tag, GST, etc.)

  • Induction conditions that maximize yield while maintaining protein folding

  • Buffer systems that preserve protein stability during purification

Special consideration should be given to membrane proteins like nqrD, which may require detergent solubilization or specialized membrane-mimetic systems for proper folding and function.

What purification strategies work best for nqrD and similar membrane proteins?

Purification of membrane proteins like Na(+)-translocating NADH-quinone reductase subunit D (nqrD) requires specialized approaches that maintain protein structure and function. A systematic purification strategy involves:

Purification StepMethodCritical ParametersCommon Challenges
Membrane ExtractionDetergent solubilizationDetergent type, concentration, and timeMaintaining native protein conformation
Initial CaptureAffinity chromatography (His-tag)Imidazole concentration, flow rateNon-specific binding
Intermediate PurificationIon exchange chromatographypH, salt gradientAggregation during buffer exchanges
PolishingSize exclusion chromatographyFlow rate, column selectionSample dilution
Quality ControlSDS-PAGE, Western blot, Mass spectrometrySample preparation, antibody selectionAccurate molecular weight determination

When purifying nqrD, maintaining the native conformation is crucial for functional studies. Researchers should carefully optimize detergent selection, as different membrane proteins respond differently to various detergents (DDM, LDAO, etc.). For nqrD specifically, a combination of affinity chromatography using engineered tags and size exclusion chromatography in the presence of stabilizing detergents often yields the best results for structural and functional studies.

What analytical methods are most effective for studying the structure-function relationship of nqrD?

Understanding the structure-function relationship of nqrD requires a multi-faceted analytical approach. Researchers investigating this protein typically employ:

  • Circular Dichroism (CD) Spectroscopy: For secondary structure analysis and folding assessment

  • Protein Crystallography or Cryo-EM: For high-resolution structural determination

  • Site-Directed Mutagenesis: To identify critical residues involved in catalysis or ion translocation

  • Isothermal Titration Calorimetry (ITC): To measure binding affinities with substrates

  • Enzymatic Activity Assays: Using spectrophotometric methods to monitor NADH oxidation

These approaches can be complemented with computational methods such as molecular dynamics simulations to predict protein behavior in membrane environments. When designing experiments to study nqrD function, researchers should consider reconstituting the protein into proteoliposomes or nanodiscs to better mimic the native membrane environment, which is essential for accurate functional characterization of membrane-bound enzymes like Na(+)-translocating NADH-quinone reductase.

How is the nqrD gene regulated in H. ducreyi?

Gene regulation in H. ducreyi, including that of nqrD, involves complex mechanisms that can be influenced by environmental factors and growth conditions. Research on H. ducreyi gene regulation has shown that the RNA chaperone Hfq contributes significantly to virulence gene regulation . In fact, insertional inactivation of hfq altered the expression of approximately 16% of H. ducreyi genes .

Growth phase also plays an important role in gene regulation in H. ducreyi. Studies have shown that compared to mid-log-phase organisms, cells harvested from the stationary phase upregulated genes encoding several virulence determinants and a homolog of hfq . This suggests that genes involved in energy metabolism, such as those encoding components of the Na(+)-translocating NADH-quinone reductase complex including nqrD, may be differentially regulated based on growth phase and energy requirements of the cell.

Unlike many Gram-negative bacteria that utilize the alternative sigma factor RpoS to adapt to stresses encountered in stationary phase, H. ducreyi lacks an RpoS homolog . This raises important questions about how stationary-phase adaptation, including the regulation of metabolic genes like nqrD, is controlled in this organism.

What genetic tools are available for manipulating nqrD expression in H. ducreyi?

  • Plasmid-based expression systems: Similar to the pTETnir15 plasmid used for HgbA expression

  • Insertional inactivation methods: As demonstrated with hfq gene manipulation

  • Quantitative PCR techniques: For accurate measurement of gene expression levels

  • DNA microarray analysis: For genome-wide expression studies

For researchers specifically interested in nqrD, quantitative reverse transcription PCR (qRT-PCR) has been validated as a reliable method for measuring transcript levels in H. ducreyi. Studies have shown a strong correlation between log2 values obtained by DNA microarray analysis and qRT-PCR analysis , suggesting that either method would be suitable for investigating nqrD expression under various conditions.

What is known about the evolutionary conservation of nqrD across bacterial species?

The Na(+)-translocating NADH-quinone reductase complex is found in various bacterial species, particularly those that thrive in sodium-rich environments. Evolutionary analysis of nqrD and other NQR subunits reveals patterns of conservation that provide insights into the functional importance of specific domains within these proteins.

Understanding the evolutionary relationships between nqrD homologs can help researchers identify conserved regions that might be essential for function, as well as variable regions that might contribute to species-specific adaptations. This information is valuable for structure-function studies and for the development of targeted antimicrobial strategies that exploit unique features of the H. ducreyi nqrD.

How can recombinant nqrD be utilized in vaccination strategies against H. ducreyi?

While no effective vaccine against chancroid has been developed to date , recombinant proteins from H. ducreyi represent potential vaccine candidates. Research with the H. ducreyi outer membrane hemoglobin receptor HgbA has demonstrated approaches that could be applied to nqrD or multi-subunit constructs.

When considering nqrD as a potential vaccine component, researchers should note the lessons learned from previous vaccine attempts. For example, in studies with recombinant HgbA delivered via an attenuated Salmonella typhimurium strain, no specific antibody to HgbA was elicited after either single or three-dose schedules, and rabbits achieved no protective immunity from homologous challenge . This highlights the importance of:

  • Ensuring stable expression of heterologous proteins in vaccine vectors

  • Optimizing antigen presentation to stimulate robust immune responses

  • Developing adjuvant strategies appropriate for membrane protein antigens

  • Considering multi-antigen approaches that target multiple aspects of H. ducreyi virulence

For nqrD specifically, its location in the bacterial membrane and role in energy metabolism make it potentially accessible to antibodies while being functionally important for bacterial survival, characteristics that could be advantageous for vaccine development.

What are the challenges in crystallizing membrane proteins like nqrD for structural studies?

Structural determination of membrane proteins like nqrD presents significant challenges that require specialized approaches. The primary difficulties include:

ChallengeDescriptionPotential Solutions
Protein StabilityMembrane proteins often become unstable when removed from their native lipid environmentUse of stabilizing detergents, lipid cubic phase crystallization
Conformational HeterogeneityMultiple conformational states can hinder crystal formationProtein engineering to lock specific conformations
Crystal PackingLimited hydrophilic surfaces for crystal contactsFusion with crystallization chaperones (e.g., T4 lysozyme)
Phase DeterminationLack of homologous structures for molecular replacementHeavy atom derivatives, selenomethionine incorporation
Diffraction QualityMembrane protein crystals often diffract poorlyOptimization of crystallization conditions, microfocus beamlines

For nqrD specifically, researchers might consider alternative structural biology approaches like cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structural studies in recent years. Another promising approach is the use of membrane mimetics such as nanodiscs or amphipols that better preserve the native-like environment of membrane proteins during structural studies.

How does nqrD contribute to the bioenergetics and pathogenesis of H. ducreyi?

As a component of the Na(+)-translocating NADH-quinone reductase complex, nqrD plays a crucial role in the bioenergetics of H. ducreyi. This respiratory complex couples the oxidation of NADH to the generation of a sodium gradient across the bacterial membrane, which can subsequently drive various cellular processes.

The significance of nqrD in H. ducreyi pathogenesis likely stems from its role in energy metabolism, which supports various virulence mechanisms. Research on H. ducreyi has demonstrated that genes encoding several virulence determinants are upregulated during the stationary phase , suggesting a potential link between metabolic adaptation and virulence.

The NQR complex may be particularly important for H. ducreyi survival in the human host environment, where adapting to changing nutrient availability and maintaining energy homeostasis are essential for persistent infection. Investigating the specific contribution of nqrD to these processes could reveal new insights into H. ducreyi pathogenesis and identify potential targets for therapeutic intervention.

What are common problems encountered when working with recombinant H. ducreyi proteins, and how can they be addressed?

Researchers working with recombinant H. ducreyi proteins frequently encounter several challenges. Based on experiences documented with HgbA and other H. ducreyi proteins, common issues and solutions include:

  • Expression instability: HgbA expression was restricted to plasmid isolates recovered one day after immunization . This suggests that expression stability is a significant challenge. Researchers should consider:

    • Using stronger promoters with tight regulation

    • Optimizing codon usage for the expression host

    • Testing multiple expression vectors and host strains

    • Implementing continuous culture selection strategies

  • Protein folding and solubility: Membrane proteins like nqrD often require specialized approaches:

    • Expressing as fusion proteins with solubility enhancers

    • Testing various detergents for solubilization

    • Optimizing temperature and growth conditions during expression

    • Employing molecular chaperones to assist proper folding

  • Functional assessment: Verifying that recombinant proteins retain native activity:

    • Developing activity assays that can be performed in detergent-solubilized state

    • Comparing enzymatic parameters with native protein when possible

    • Using structural probes (CD spectroscopy, limited proteolysis) to assess folding

How can researchers optimize protein yield and activity for recombinant nqrD?

Optimizing the yield and activity of recombinant nqrD requires systematic investigation of expression and purification conditions. Based on approaches used with other membrane proteins, the following strategies are recommended:

  • Expression optimization:

    • Test multiple expression vectors with different fusion tags (His, GST, MBP)

    • Evaluate various expression hosts (E. coli strains, yeast systems)

    • Screen induction conditions (temperature, inducer concentration, duration)

    • Consider cell-free expression systems for toxic membrane proteins

  • Purification optimization:

    • Compare detergents for membrane solubilization (DDM, LMNG, LDAO)

    • Determine optimal buffer compositions for each purification step

    • Identify stabilizing additives (glycerol, specific lipids, reducing agents)

    • Develop rapid purification protocols to minimize degradation

  • Activity preservation:

    • Reconstitute purified protein into liposomes or nanodiscs

    • Optimize lipid composition to mimic native membrane environment

    • Develop robust activity assays for quality control

    • Store protein under conditions that maintain long-term stability

A systematic approach to these optimizations, potentially using design of experiments (DoE) methodology, can significantly improve both yield and functional quality of recombinant nqrD.

What controls and validation methods should be included in functional studies of nqrD?

Rigorous controls and validation methods are essential for ensuring reliable results in functional studies of nqrD. Researchers should implement:

  • Positive and negative controls:

    • Purified native NQR complex (positive control)

    • Denatured nqrD or heat-inactivated samples (negative control)

    • Site-directed mutants with predicted loss of function

    • Known inhibitors of NQR activity

  • Protein quality validation:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Size exclusion chromatography to assess oligomeric state

    • Mass spectrometry to verify protein sequence and modifications

    • Circular dichroism to confirm secondary structure integrity

  • Functional validation approaches:

    • Multiple independent assays measuring different aspects of activity

    • Concentration-dependent measurements to establish kinetic parameters

    • Comparison of activity in different membrane mimetic environments

    • Assessment of ion specificity using ion substitution experiments

  • Data analysis rigor:

    • Statistical analysis of replicate experiments

    • Correlation between structural integrity and functional activity

    • Comparison with literature values when available

    • Consideration of potential artifacts introduced by recombinant production

By implementing these controls and validation methods, researchers can generate robust and reproducible data on nqrD function that will withstand scientific scrutiny.

How might inhibitors of nqrD be developed as potential antimicrobial agents?

The essential role of the Na(+)-translocating NADH-quinone reductase complex in bacterial bioenergetics makes it an attractive target for antimicrobial development. Potential approaches for developing nqrD inhibitors include:

  • Structure-based drug design:

    • Using structural data to identify potential binding pockets

    • Virtual screening of compound libraries against these targets

    • Fragment-based discovery approaches

  • Functional screening strategies:

    • High-throughput assays measuring NQR activity inhibition

    • Whole-cell screening with counter-screens to confirm specificity

    • Phenotypic screens focusing on energy metabolism disruption

  • Repurposing existing compounds:

    • Testing known respiratory chain inhibitors against NQR

    • Evaluating natural products with reported antimicrobial activity

    • Investigating compounds that target homologous proteins in other bacteria

The development process should include rigorous assessment of inhibitor specificity to minimize off-target effects on human cells, as well as evaluation of resistance development potential through serial passage experiments.

What novel experimental approaches are emerging for studying membrane proteins like nqrD?

Several cutting-edge methodologies are transforming research on membrane proteins like nqrD:

  • Advanced structural biology techniques:

    • Single-particle cryo-electron microscopy at near-atomic resolution

    • Microcrystal electron diffraction (MicroED)

    • Integrative structural biology combining multiple data sources

  • Membrane mimetic systems:

    • Native nanodiscs extracted directly from bacterial membranes

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

    • Artificial membrane systems with controlled composition

  • Functional characterization approaches:

    • Single-molecule fluorescence resonance energy transfer (smFRET)

    • Automated patch-clamp systems for ion translocation studies

    • Label-free technologies for monitoring binding interactions

  • Computational methods:

    • Enhanced sampling molecular dynamics simulations

    • Machine learning approaches for structure prediction

    • Systems biology models incorporating protein function data

These emerging technologies offer new possibilities for understanding the structure, dynamics, and function of challenging membrane proteins like nqrD, potentially accelerating both basic science discoveries and applied research for therapeutic development.

How does research on nqrD contribute to our broader understanding of bacterial bioenergetics?

Research on H. ducreyi nqrD contributes significantly to our understanding of alternative respiratory pathways in bacteria. While the proton-pumping NADH:ubiquinone oxidoreductase (Complex I) is well-studied in many organisms, the Na(+)-translocating NADH-quinone reductase represents an evolutionary distinct solution to the challenge of coupling electron transport to ion translocation.

Comparative studies between these systems can reveal fundamental principles of energy conversion in biological systems and illuminate the diverse strategies that have evolved for harnessing redox energy. Additionally, understanding the specific adaptations of the H. ducreyi NQR complex may provide insights into how this pathogen has optimized its energy metabolism for survival in its specific host environment.

The study of nqrD and the NQR complex also contributes to our broader understanding of membrane protein complexes and their assembly, stability, and regulation—knowledge that extends beyond bioenergetics to inform research on various membrane-associated cellular processes.

What are the most promising future research directions for H. ducreyi nqrD studies?

Several promising research directions could significantly advance our understanding of H. ducreyi nqrD:

  • Integrative structural biology: Combining cryo-EM, cross-linking mass spectrometry, and computational modeling to determine the structure of the entire NQR complex

  • Host-pathogen interactions: Investigating how nqrD and energy metabolism adapt during infection and in response to host immune factors

  • Regulatory networks: Exploring how nqrD expression is controlled within the context of H. ducreyi's unique regulatory landscape, particularly in light of its lack of RpoS

  • Antimicrobial development: Using structure-function insights to design targeted inhibitors of the NQR complex as potential therapeutics for chancroid

  • Synthetic biology applications: Engineering the NQR complex for biotechnological applications in bioenergy or biosensing

These directions represent areas where significant knowledge gaps exist and where new discoveries could have broad implications for both basic science and applied research.

How might a systems biology approach enhance our understanding of nqrD in the context of H. ducreyi pathogenesis?

A systems biology approach would integrate multiple layers of biological information to contextualize nqrD function within the broader network of H. ducreyi pathogenesis:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlating nqrD expression with metabolic flux changes

    • Mapping interactions between energy metabolism and virulence pathways

  • Network analysis:

    • Identifying key regulators that coordinate nqrD expression with other genes

    • Modeling how perturbations in energy metabolism affect virulence networks

    • Discovering potential feedback loops between metabolism and virulence

  • Host-pathogen system modeling:

    • Incorporating host responses to H. ducreyi infection

    • Predicting metabolic adaptations during different infection stages

    • Identifying critical nodes where therapeutic intervention might be most effective

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.