Recombinant Haemophilus ducreyi Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characterization

Recombinant NqrE subunits are typically expressed in Escherichia coli with affinity tags (e.g., His-tag) for purification. For example:

PropertyDetails for Vibrio anguillarum NqrE
Expression HostE. coli
TagN-terminal His tag
Amino Acid Range1–198 aa (Full-length)
Molecular Weight~22–25 kDa (calculated)
FunctionIntegral membrane protein; part of Na(+)-NQR complex

Notes:

  • Purification methods often involve Ni-NTA affinity chromatography .

  • Structural studies of homologous NqrE subunits in V. cholerae reveal conserved domains critical for binding cofactors like FMN and iron-sulfur clusters .

Role in Bacterial Pathogenesis

While H. ducreyi NqrE has not been directly studied, Na(+)-NQR systems in pathogens contribute to virulence by:

  • Stress Adaptation: Supporting survival under low-oxygen or anaerobic conditions encountered during infection .

  • Bioenergetics: Maintaining ion gradients essential for nutrient import and efflux of antimicrobial agents .

  • Link to Virulence Factors: In H. ducreyi, stationary-phase gene regulation (mediated by proteins like Hfq) controls virulence determinants such as cytotoxins and adhesion proteins . Though NqrE is not explicitly linked here, its role in energy metabolism may indirectly influence virulence gene expression.

Research Gaps and Comparative Insights

  • Homology: H. ducreyi NqrE shares sequence homology with Vibrio NqrE (e.g., conserved FMN-binding domains), suggesting similar mechanistic roles .

  • Experimental Data: No direct studies on H. ducreyi NqrE exist in the literature reviewed. Current knowledge relies on:

    • Genetic Context: The nqr operon structure in H. ducreyi remains uncharacterized.

    • Functional Analogues: Sodium-dependent NADH dehydrogenases in other pathogens .

Technical Applications

Recombinant NqrE has potential uses in:

  • Antimicrobial Development: As a target for inhibitors disrupting ion gradients in pathogenic bacteria .

  • Structural Biology: For resolving electron transport mechanisms via cryo-EM or X-ray crystallography .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
nqrE; HD_0383; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
nqrE
Target Protein Sequence
MEHLLSIFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPVNQLVY THILKDGVLVDGVDLSFLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNC AIFGGVSFMVQREYDLVESVVYGIGAGTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITF ITVGLMALGFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol in two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: hdu:HD_0383

STRING: 233412.HD0383

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.