Recombinant Haemophilus ducreyi Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Haemophilus ducreyi Probable Ubiquinone Biosynthesis Protein UbiB (UbiB)

Haemophilus ducreyi is a Gram-negative bacterium known to cause chancroid, a sexually transmitted infection characterized by painful ulcers, primarily in regions with limited healthcare resources . Ubiquinone, also known as coenzyme Q (CoQ), is essential for aerobic respiration . It acts as an electron carrier in the electron transport chain. The probable ubiquinone biosynthesis protein UbiB, is likely a protein kinase regulator of UbiI activity which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis .

UbiB Protein Function and Role in Ubiquinone Biosynthesis

UbiB is involved in the aerobic biosynthesis of ubiquinone, an essential component for cellular bioenergetics . Ubiquinone is a co-substrate in the electron transport chain, facilitating the transfer of electrons and protons in the inner mitochondrial membrane . Disruption of ubiquinone biosynthesis can lead to various metabolic and physiological consequences, affecting the bacterium's ability to produce energy and respond to environmental stresses .

UbiB as a Target for Drug Development

The significance of UbiB in bacterial metabolism makes it a potential target for developing new antibacterial agents. Inhibiting UbiB could disrupt the ubiquinone biosynthesis pathway, impairing bacterial respiration and energy production .

Haemophilus ducreyi and Two-Component Regulatory Systems

The CpxRA two-component regulatory system in Haemophilus ducreyi affects the expression of virulence factors . Inactivation of CpxR leads to increased expression of LspB and LspA2, proteins that are part of a two-partner secretion system required for H. ducreyi's virulence . Further research might reveal a connection between the CpxRA system and UbiB or ubiquinone biosynthesis, suggesting a regulatory link between virulence and metabolism.

Tables

Table 1: Recombinant Haemophilus somnus UbiB Protein Details

CategoryAttribute
SourceE. coli
TagHis
Protein LengthFull Length (1-544aa)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Gene NameubiB
SynonymsubiB; HS_0544; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
UniProt IDQ0I208

Table 2: Predicted Functional Partners of UbiG Protein (Haemophilus ducreyi)

ProteinDescription
VisCProbable monoxygenase.
UbiFPutative 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase.
UbiA4-hydroxybenzoate octaprenyltransferase; Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group.
UbiEUbiquinone/menaquinone biosynthesis methyltransferase; Methyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3- methyl-6-methoxy-1,4-benzoquinol (DMQH2).
UbiBProbable ubiquinone biosynthesis protein; Is probably a protein kinase regulator of UbiI activity which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
HD_1749Conserved hypothetical protein.
MnmCCatalyzes the last two steps in the biosynthesis of 5- methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at the wobble position (U34) in tRNA. Catalyzes the FAD-dependent demodification of cmnm(5)s(2)U34 to nm(5)s(2)U34, followed by the transfer of a methyl group from S-adenosyl-L-methionine to nm(5)s(2)U34, to form mnm(5)s(2)U34; In the N-terminal section; belongs to the methyltransferase superfamily. tRNA (mnm(5)s(2)U34)-methyltransferase family.
YajCConserved hypothetical protein; The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes.
QueFPossible GTP cyclohydrolase I; Catalyzes the NADPH-dependent reduction of 7-cyano-7- deazaguanine (preQ0) to 7-aminomethyl-7-deazaguanine (preQ1).
GyrADNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiB; HD_0717; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-542
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
ubiB
Target Protein Sequence
MIFKNTRRSYQIIATFLRYGIDEIIPDIPFTYSARLTRKAFFWLQNEHKDQPFGVRLRLA LQELGPVWIKLGQMLATRRDLFEPALADQLALLQDSVAPFDGKLARKIIEQALGNTLETW FDDFDEQALASASIAQVHTATFNKNQPLAGQNVVLKVIRPDIEHIIKADIALMYQLAKLI PYLSDDAKRLRATEVVREYEKTLLDELDLTREMANAIRLRNNFENSEMLYVPAMYPDFCH KNVIVMERIYGIPVSDIATLTENGTNMKLLAERGVQVFFTQVFRDSFFHADMHAGNIFVN PNHPEDPQYIGIDCGIVGTLNQNDKRYLAESFVAFFNRDYRRVALMHIESGWTPADTDVD AFEEAFRTVCEPIFAKPLAEISFGQVLLNLFNVARQFNMEVQPQLVLLQKTLLYIEGLGR QVYPALDLWQTAKPFLQKWLDQQVGFKAILRDLKQQAPQFREHFAQFPEAVFNALQQQKH INYRLAELNKTLQSQADNKTYNVKMIIMGSIILSLLWQFNSLPLWLSLPILTMLCLALCR RK
Uniprot No.

Target Background

Function
This protein likely functions as a protein kinase regulator of UbiI activity, which participates in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links

KEGG: hdu:HD_0717

STRING: 233412.HD0717

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Haemophilus ducreyi and what is its significance in infectious disease research?

Haemophilus ducreyi is a gram-negative coccobacillus that causes the genital ulcer disease chancroid and painful cutaneous ulcers in children living in tropical regions . As an obligate human pathogen, H. ducreyi lacks the biosynthetic pathway for heme synthesis and must acquire heme and iron from the host to survive . The bacterium has become increasingly recognized as a major cause of non-genital cutaneous ulcers, while simultaneously experiencing a reduction in its association with genital ulcer disease (GUD) globally .

Research approaches to studying this pathogen include:

  • Human infection models that mirror natural disease progression

  • Molecular typing methods that have identified two distinct clades (class I and II)

  • Whole-genome sequencing of clinical isolates without prior culturing

  • Transcriptomic analyses to identify genes expressed during infection

The pathogen is particularly significant as a model organism for studying host-pathogen interactions because of the FDA-approved human infection model, which allows direct investigation of bacterial pathogenesis and host immune responses .

  • What is UbiB protein and what functions does it serve in Haemophilus ducreyi?

The UbiB protein in H. ducreyi is classified as a probable ubiquinone biosynthesis protein . Based on sequence homology and functional studies in related bacteria, UbiB likely plays a critical role in:

  • Biosynthesis of ubiquinone (Coenzyme Q), an essential component of the electron transport chain

  • Energy metabolism and bacterial respiration

  • Adaptation to oxidative stress conditions within the host

The amino acid sequence of H. ducreyi UbiB (from strain 35000HP) consists of 542-544 amino acids with characteristic domains including :

  • An N-terminal domain involved in substrate binding

  • A central catalytic domain

  • A C-terminal membrane-associated region

While specific research on UbiB function in H. ducreyi is limited, studies in related organisms suggest it may function as a protein kinase in the ubiquinone biosynthetic pathway. The protein likely becomes particularly important during infection when the bacterium must adapt to nutrient limitation and oxidative stress within the inflammatory microenvironment .

  • How can researchers express and purify recombinant H. ducreyi UbiB protein?

Expression and purification of recombinant H. ducreyi UbiB requires a methodical approach:

Expression System Selection:

  • E. coli is the preferred heterologous expression system for H. ducreyi proteins

  • BL21(DE3) or similar strains designed for high-level expression are recommended

  • Expression vectors containing T7 or similar strong promoters with inducible control

Optimization Protocol:

  • Clone the full-length ubiB gene (coding for amino acids 1-544) into an expression vector with an N-terminal His-tag

  • Transform the construct into E. coli expression strain

  • Grow transformed cells in rich media (e.g., LB) at 37°C until mid-log phase

  • Induce protein expression with IPTG (0.1-1.0 mM) at lower temperature (16-25°C) to improve solubility

  • Harvest cells after 4-16 hours of induction

Purification Strategy:

  • Resuspend cell pellet in lysis buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10% glycerol

    • Protease inhibitors

  • Lyse cells by sonication or French press

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Purify using nickel affinity chromatography

  • Elute with imidazole gradient (20-250 mM)

  • Further purify by size exclusion chromatography if needed

Storage Recommendations:

  • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

  • What are the functional validation methods for recombinant H. ducreyi UbiB?

Confirming the functionality of recombinant UbiB requires multiple complementary approaches:

Structural Validation:

  • SDS-PAGE to confirm purity and expected molecular weight (approximately 60 kDa)

  • Circular dichroism to assess secondary structure

  • Limited proteolysis to confirm proper folding

Functional Assays:

  • Enzymatic activity assays measuring kinase activity using radiolabeled ATP

  • Ubiquinone biosynthesis complementation assays in E. coli ubiB mutants

  • Measurement of electron transport activity in reconstituted systems

Binding Studies:

  • Isothermal titration calorimetry to measure binding of putative substrates

  • Surface plasmon resonance to quantify interaction kinetics with potential partners

  • Pull-down assays to identify interacting proteins from H. ducreyi lysates

Biological Relevance:

  • Complementation of ubiB mutants of H. ducreyi (if available)

  • Expression analysis during different growth conditions

  • Correlation with metabolomic profiles of H. ducreyi during infection

Advanced Research Questions

  • How might UbiB contribute to H. ducreyi pathogenesis based on current knowledge of metabolic adaptation during infection?

While direct evidence for UbiB's role in H. ducreyi pathogenesis is limited, several lines of investigation suggest potential contributions:

Energy Metabolism and Survival:

  • Transcriptome analysis reveals that metabolic genes, including those involved in respiration, are differentially regulated during infection

  • Ubiquinone is essential for aerobic and anaerobic respiration, suggesting UbiB may be critical for adaptation to microaerophilic conditions in infection sites

Integration with Virulence Regulation:

  • The CpxRA two-component system, the only intact signal transduction system in H. ducreyi, regulates numerous metabolic pathways

  • Metabolic adaptation and virulence factor expression are likely coordinated responses, with UbiB potentially playing a role in this network

Host-Pathogen Metabolic Interface:

  • Recent host-pathogen interaction studies using dual RNA-seq have identified correlations between bacterial anaerobic metabolism genes and host inflammatory responses

  • The table below summarizes metabolic adaptations observed in H. ducreyi during human infection:

Metabolic PathwayRegulation during InfectionPotential UbiB Involvement
Electron transport chainUpregulatedDirect (ubiquinone biosynthesis)
Anaerobic respirationUpregulatedIndirect (redox balance)
Iron/heme acquisitionUpregulatedIndirect (energy for transport)
Central carbon metabolismAltered fluxIndirect (energy production)
Stress responseUpregulatedDirect (oxidative stress protection)

Implications for Persistence:

  • H. ducreyi must adapt to the changing metabolic environment of developing lesions

  • UbiB-mediated ubiquinone biosynthesis may be crucial for bacterial persistence in the face of host nutritional immunity and oxidative burst

  • What experimental models are available for studying H. ducreyi virulence factors and how could they be applied to UbiB research?

H. ducreyi research benefits from a unique human infection model that has been FDA-approved for nearly three decades . This and other models can be leveraged for UbiB research:

Human Infection Model:

  • Allows controlled inoculation of wild-type and mutant strains into the skin of volunteers

  • Enables direct assessment of bacterial gene expression in human infection

  • Permits sampling through biopsy for transcriptomic and metabolomic analyses

  • Has been used to test 34 different H. ducreyi mutants to define virulence requirements

Experimental Protocol for Human Infection Model:

  • Multi-stage, dose-ranging studies with double-blinding

  • Inoculation at three sites on skin overlying deltoid muscle

  • Daily monitoring of lesion progression

  • Collection of biopsy samples at defined timepoints

  • Assessment of bacterial burden and host response

Mutant vs. Parent Comparison Studies:

  • Construction of an isogenic ubiB deletion mutant using recombineering methodology

  • Comparative assessment of growth in defined media with different carbon sources

  • Testing mutant virulence against parent strain in human volunteers

  • Sequencing validation of mutant by whole-genome sequencing

In Vitro Cellular Models:

  • Co-culture with human immune cells to assess survival and persistence

  • Gene expression analysis under conditions mimicking in vivo environment

  • Assessment of metabolic capabilities using defined nutrient limitations

Metabolomic Approaches:

  • Analysis of metabolite utilization by wild-type vs. ubiB mutants

  • Isotope labeling to track carbon flux through central metabolism

  • Integration with transcriptomic data from infected tissues

The ability to perform both in vitro characterization and in vivo validation in humans provides an exceptionally powerful platform for understanding the role of metabolic genes like ubiB in pathogenesis.

  • How do genetic and structural features of H. ducreyi UbiB compare with homologs in other bacterial species?

Comparative analysis of UbiB across bacterial species reveals important insights about evolutionary conservation and potential functional differences:

Sequence Conservation:

  • The H. ducreyi UbiB protein shows significant homology to UbiB from other gamma-proteobacteria

  • Alignment with E. coli UbiB reveals ~70% sequence identity in the catalytic domain

  • H. somnus UbiB (a related Haemophilus species) shares ~85% identity with H. ducreyi UbiB

Key Structural Features:

  • All bacterial UbiB proteins contain a conserved ATP-binding domain

  • H. ducreyi UbiB possesses the characteristic kinase motifs found in homologs

  • The C-terminal region contains predicted transmembrane domains that anchor the protein to the cytoplasmic membrane

Comparative Domain Structure of UbiB Across Species:

SpeciesFull Length (aa)N-terminal DomainCatalytic DomainC-terminal RegionNotable Features
H. ducreyi542-544aa 1-120aa 121-410aa 411-544Putative membrane-associated C-terminus
E. coli546aa 1-125aa 126-415aa 416-546Well-characterized kinase activity
H. somnus544aa 1-120aa 121-410aa 411-544High similarity to H. ducreyi

Functional Conservation:

  • The enzymatic function as a kinase in ubiquinone biosynthesis appears conserved

  • Species-specific differences may exist in regulation and interaction partners

  • Environmental adaptation may drive subtle differences in catalytic efficiency

Evolutionary Context:

  • UbiB represents an ancient and highly conserved protein in the bacterial kingdom

  • The high degree of conservation suggests essential function

  • Differences in the C-terminal region may reflect adaptation to specific membrane environments

  • What are the current methodologies for studying UbiB-mediated ubiquinone biosynthesis in H. ducreyi?

Investigating UbiB function in ubiquinone biosynthesis requires specialized approaches:

Genetic Manipulation:

  • Construction of unmarked, in-frame deletion mutants of ubiB using recombineering methodology

  • Complementation with wild-type and site-directed mutant versions of ubiB

  • Creation of reporter fusions to monitor expression under different conditions

Biochemical Approaches:

  • Extraction and quantification of ubiquinone from wild-type and mutant bacteria using HPLC

  • In vitro reconstitution of enzymatic activity using purified components

  • Tracking of labeled precursors through the ubiquinone biosynthetic pathway

Growth and Survival Assays:

  • Comparison of growth kinetics between wild-type and ubiB mutants under:

    • Aerobic vs. anaerobic conditions

    • Different carbon source availability

    • Oxidative stress conditions

    • Iron/heme limitation resembling host environment

Systems Biology Integration:

  • Correlative analysis of transcriptomics, proteomics, and metabolomics data

  • Network analysis to identify functional interactions between UbiB and other cellular components

  • Computational modeling of metabolic flux with and without functional UbiB

Host-Pathogen Interface:

  • Assessment of ubiquinone levels in bacteria recovered from experimental human infection

  • Correlation between ubiquinone production and survival in human infection model

  • Investigation of host metabolites that may influence ubiquinone biosynthesis

Methodological Questions

  • What are the optimal conditions for expressing recombinant H. ducreyi UbiB in E. coli?

Successful expression of recombinant H. ducreyi UbiB requires careful optimization of multiple parameters:

Expression System Selection:

  • BL21(DE3) or Rosetta(DE3) strains are preferred for proteins with rare codons

  • pET vectors with T7 promoter provide high-level expression control

  • N-terminal His-tag facilitates purification while minimizing interference with function

Culture Optimization Protocol:

  • Transform expression construct into appropriate E. coli strain

  • Test small-scale expression (10-50 mL cultures) under different conditions:

    • Temperature: 16°C, 25°C, 30°C, 37°C

    • IPTG concentration: 0.1 mM, 0.5 mM, 1.0 mM

    • Induction time: 4h, 8h, 16h (overnight)

  • Analyze soluble vs. insoluble fractions by SDS-PAGE

  • Scale up using optimal conditions (typically lower temperature, moderate IPTG)

Recommended Expression Conditions:

  • Culture medium: LB or TB (richer medium for higher yield)

  • Growth temperature: 37°C until OD600 reaches 0.6-0.8

  • Induction temperature: 16-18°C

  • IPTG concentration: 0.2-0.5 mM

  • Induction time: 16-18 hours (overnight)

  • Harvest by centrifugation at 5,000 × g for 15 minutes

Solubility Enhancement Strategies:

  • Addition of 0.1-0.5% glucose to media to reduce basal expression

  • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Addition of 1-5% ethanol or 3% sorbitol to induce stress responses that improve folding

  • Use of auto-induction media for gradual protein expression

Quality Control Metrics:

  • Expected yield: 5-15 mg per liter of culture

  • Purity assessment by SDS-PAGE: >90% purity after affinity purification

  • Western blot confirmation using anti-His antibodies

  • Activity assessment through functional assays

  • What purification strategies yield the highest purity and activity of recombinant H. ducreyi UbiB?

Purification of recombinant UbiB requires a systematic approach to preserve structure and function:

Lysis Optimization:

  • Resuspend cell pellet in buffer containing:

    • 50 mM Tris-HCl (pH 8.0)

    • 300-500 mM NaCl

    • 10% glycerol

    • 1-5 mM β-mercaptoethanol or DTT

    • 1 mM PMSF or protease inhibitor cocktail

  • Lyse cells by sonication (10 cycles of 30s on/30s off) or French press

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

Multi-step Purification Strategy:

  • IMAC (Immobilized Metal Affinity Chromatography):

    • Load clarified lysate onto Ni-NTA or TALON resin

    • Wash with buffer containing 20-40 mM imidazole

    • Elute with 250-300 mM imidazole

    • Pool fractions containing UbiB based on SDS-PAGE analysis

  • Ion Exchange Chromatography (optional secondary step):

    • Dialyze IMAC-purified protein against low-salt buffer

    • Apply to anion exchange column (e.g., Q Sepharose)

    • Elute with salt gradient (0-500 mM NaCl)

  • Size Exclusion Chromatography (final polishing step):

    • Apply concentrated protein to Superdex 200 or similar column

    • Elute with storage buffer (Tris-based buffer with 6% trehalose, pH 8.0)

    • Collect fractions and analyze by SDS-PAGE

Storage Buffer Optimization:

  • Final buffer composition: 20-50 mM Tris-HCl (pH 8.0), 100-150 mM NaCl, 50% glycerol

  • Alternative: Lyophilization from Tris/PBS-based buffer with 6% trehalose

  • Store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles

Activity Preservation:

  • Determine activity immediately after purification as baseline

  • Test stability under different storage conditions (4°C, -20°C, -80°C)

  • Monitor activity after storage to establish shelf-life

  • Consider addition of stabilizing agents if activity loss is observed

  • What experimental approaches can be used to study the role of UbiB in H. ducreyi pathogenesis?

Investigating UbiB's role in pathogenesis requires a multi-faceted approach:

Genetic Manipulation Strategies:

  • Mutant Construction and Characterization:

    • Create unmarked, in-frame deletion of ubiB using recombineering

    • Verify mutation by whole-genome sequencing to ensure no off-target effects

    • Create complemented strain expressing wild-type ubiB in trans

    • Engineer point mutations in key catalytic residues

  • Growth and Phenotypic Analysis:

    • Compare growth kinetics in standard media and under stress conditions

    • Assess survival during exposure to oxidative stress

    • Measure membrane potential and proton motive force

    • Quantify ubiquinone levels by HPLC

Human Infection Model Studies:

  • Mutant vs. Parent Trials:

    • Inoculate volunteers with parent and ubiB mutant strains

    • Monitor papule and pustule formation rates

    • Collect biopsy specimens for transcriptomic and metabolomic analyses

    • Perform colony hybridization to confirm mutant identity in recovered bacteria

  • Host Response Analysis:

    • Compare inflammatory infiltrate between parent and mutant infections

    • Analyze cytokine profiles in tissue

    • Assess local metabolite concentrations

    • Measure oxidative stress markers

Systems Biology Approaches:

  • Dual RNA-Seq Analysis:

    • Extract total RNA from infected tissue

    • Perform dual RNA-seq to capture both host and bacterial transcripts

    • Identify differentially expressed genes when UbiB is absent

    • Construct interaction networks between host and bacterial gene clusters

  • Metabolomic Integration:

    • Compare metabolite profiles between wild-type and ubiB mutant infections

    • Trace isotope-labeled carbon through central metabolism

    • Identify metabolic bottlenecks in the absence of UbiB

    • Correlate metabolite changes with transcriptomic data

Potential Outcomes and Interpretations:

  • If ubiB mutant is attenuated: UbiB likely essential for energy metabolism during infection

  • If ubiB mutant is partially attenuated: UbiB important but redundant systems exist

  • If ubiB mutant is fully virulent: UbiB may be dispensable or functionally redundant

  • How can researchers correlate in vitro findings about H. ducreyi UbiB with in vivo significance?

Bridging in vitro studies with in vivo relevance requires strategic methodological approaches:

Translational Methodology:

  • Physiologically Relevant Conditions:

    • Culture bacteria under conditions that mimic the human infection environment:

      • Low oxygen tension

      • Nutrient limitation

      • Presence of host factors (serum, antimicrobial peptides)

    • Compare gene expression and protein levels between in vitro and ex vivo samples

  • Ex Vivo Systems:

    • Isolate bacteria from experimental human infections

    • Immediately preserve for transcriptomic/proteomic analysis

    • Compare with in vitro grown bacteria to identify infection-specific changes

    • Validate specific findings with targeted approaches (qRT-PCR, Western blot)

Comparative Analysis Framework:

  • Multi-omics Integration:

    • Generate matched datasets from:

      • In vitro growth (standard and stress conditions)

      • Human experimental infection samples

      • Animal model infections (if applicable)

    • Identify conserved and divergent patterns across systems

    • Focus on pathways consistently altered across models

  • Correlation Analysis:

    • Calculate correlation coefficients between:

      • UbiB expression/activity and virulence factor expression

      • Ubiquinone levels and bacterial survival in different models

      • Metabolic pathway activity and disease progression

Validation Approaches:

  • Genetic Complementation:

    • Rescue mutant phenotypes with wild-type gene expression

    • Test structure-function relationships with point mutations

    • Use inducible promoters to control timing and level of expression

  • Chemical Biology:

    • Use specific inhibitors of UbiB or ubiquinone biosynthesis

    • Administer at different stages of infection

    • Correlate inhibitor effects with genetic deletion phenotypes

Human Infection Model Advantage:

  • The human infection model provides a unique opportunity to directly validate findings

  • Lessons from the model show that 70% of volunteers develop pustules while 30% spontaneously resolve infection

  • This natural variation can be exploited to understand factors that influence UbiB function in vivo

Data Analysis and Interpretation

  • How can researchers interpret conflicting data regarding UbiB function in H. ducreyi?

Conflicting results are common in complex biological systems and require systematic approaches to resolution:

Sources of Experimental Variation:

  • Strain Differences:

    • Class I vs. Class II strains of H. ducreyi have significant genetic differences

    • Genomic context may influence UbiB function or regulation

    • Different strains may have varying levels of functional redundancy

  • Experimental Conditions:

    • Growth phase effects (log vs. stationary)

    • Media composition differences

    • Oxygen availability during culture

    • Temperature variations

  • Methodological Differences:

    • Different expression systems for recombinant protein

    • Various purification strategies affecting protein activity

    • Diverse assay systems measuring different aspects of function

Systematic Resolution Approach:

  • Standardization:

    • Use identical strains across laboratories

    • Standardize growth conditions and media formulations

    • Establish common protocols for key assays

    • Share reagents (antibodies, purified proteins, etc.)

  • Multi-method Validation:

    • Apply multiple complementary techniques to address the same question

    • Triangulate results using independent methodologies

    • Verify key findings across different experimental systems

  • Biological Context Consideration:

    • Distinguish between in vitro vs. in vivo findings

    • Consider metabolic state of bacteria during experiments

    • Evaluate environmental factors that might influence results

Decision Framework for Conflicting Data:

Conflict TypeResolution StrategyExample Application for UbiB
Different phenotypes of ubiB mutantsTest in multiple growth conditionsCompare growth in glucose vs. alternative carbon sources
Inconsistent protein activityStandardize purification and assay conditionsEstablish consensus protocol for UbiB kinase activity measurement
Varying virulence in infection modelsControl for host factors and bacterial doseUse defined inoculum and monitor host immune status
Discrepant transcriptomic dataStandardize growth phase and RNA processingCompare mid-log vs. stationary phase expression
  • What bioinformatic approaches can help understand the role of UbiB in H. ducreyi metabolism and pathogenesis?

Bioinformatic analyses provide powerful tools for generating hypotheses about UbiB function:

Sequence-Based Analyses:

  • Comparative Genomics:

    • Analyze conservation of ubiB and flanking genes across Haemophilus species

    • Identify synteny and operon structure

    • Detect regulatory elements upstream of ubiB

    • Search for paralogous genes that might provide functional redundancy

  • Structural Prediction:

    • Generate 3D structure models using AlphaFold or similar tools

    • Identify potential catalytic residues

    • Predict protein-protein interaction surfaces

    • Model substrate binding sites

Transcriptomic Data Mining:

  • Co-expression Analysis:

    • Identify genes with similar expression patterns to ubiB

    • Construct co-expression networks

    • Apply clustering algorithms to identify functional modules

    • Compare patterns across multiple conditions

  • Regulatory Network Inference:

    • Predict transcription factor binding sites in ubiB promoter

    • Identify potential regulators based on expression correlation

    • Model regulatory circuits involving ubiB

    • Integrate with CpxRA regulatory data

Systems Biology Integration:

  • Metabolic Pathway Analysis:

    • Map UbiB into H. ducreyi metabolic network

    • Identify critical nodes and bottlenecks

    • Simulate flux changes upon UbiB deletion

    • Predict metabolic adaptations to compensate for UbiB loss

  • Host-Pathogen Interaction Networks:

    • Generate interaction networks between host and bacterial gene clusters

    • Identify correlations between UbiB expression and host responses

    • Predict metabolic crosstalk at the host-pathogen interface

    • Model the impact of host metabolites on bacterial metabolism

Implementation Example:
A dual RNA-seq approach used in H. ducreyi research revealed that genes involved in anaerobiosis (potentially including ubiB) correlated with several pro-inflammatory host genes upregulated during infection . This type of analysis can generate specific hypotheses about how UbiB-dependent metabolic adaptations influence host responses.

  • How can researchers design experiments to determine whether UbiB could be a viable target for antimicrobial development against H. ducreyi?

Evaluating UbiB as a potential therapeutic target requires systematic assessment:

Target Validation Strategy:

  • Essentiality Assessment:

    • Create conditional mutants of ubiB to determine growth requirements

    • Test survival in various media and under infection-relevant conditions

    • Evaluate competitive fitness of ubiB mutants vs. wild-type

    • Determine if synthetic lethality exists with other pathways

  • Human Infection Model Testing:

    • Compare virulence of wild-type and ubiB mutant in human volunteers

    • Determine if attenuation is complete or partial

    • Assess bacterial load and survival in tissue

    • Monitor host immune response to infection

High-Throughput Screening Approaches:

  • Assay Development:

    • Establish biochemical assays measuring UbiB kinase activity

    • Develop cell-based assays for ubiquinone biosynthesis

    • Create reporter strains with growth coupled to UbiB function

    • Optimize for 96 or 384-well format

  • Compound Library Screening:

    • Test natural product libraries

    • Screen focused kinase inhibitor libraries

    • Evaluate structure-based designed compounds

    • Analyze existing antibiotics for secondary effects on UbiB

Lead Validation Framework:

  • Specificity Assessment:

    • Test activity against purified UbiB protein

    • Evaluate effects on closely related proteins

    • Check for activity against human homologs

    • Determine spectrum of activity across bacterial species

  • Efficacy Testing:

    • Determine minimum inhibitory concentration (MIC)

    • Measure time-kill kinetics

    • Assess activity under various physiological conditions

    • Test in ex vivo models with human tissue

Potential Development Challenges:

  • Membrane association of UbiB may complicate drug accessibility

  • Functional redundancy in metabolic pathways

  • Development of resistance through alternate pathways

  • Need for penetration into bacterial biofilms

Combination Therapy Potential:

  • Evaluate synergy with existing antibiotics

  • Test combinations with inhibitors of complementary pathways

  • Consider pairing with drugs targeting virulence factors

  • Assess efficacy with host-directed therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.