Recombinant Haemophilus ducreyi Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role of Lgt in Haemophilus ducreyi

Lgt is essential for post-translational modification of lipoproteins, which anchor these proteins to the bacterial outer membrane. In H. ducreyi, lipoproteins contribute to virulence, immune evasion, and nutrient acquisition. Key findings include:

  • LOS Biosynthesis: H. ducreyi lipoproteins interact with lipooligosaccharide (LOS) biosynthesis pathways. Disruption of glycosyltransferase genes (e.g., lgtF) alters LOS structure and reduces virulence .

  • Complementation Studies: Recombinant expression of glycosyltransferase genes (e.g., lgt3 from Moraxella catarrhalis) in H. ducreyi mutants restores LOS epitopes, demonstrating functional conservation among bacterial Lgt homologs .

Recombinant Applications and Inhibitor Development

Recombinant Lgt homologs are used to study antibiotic resistance mechanisms and develop inhibitors:

  • Antibacterial Targets: Lgt inhibitors (e.g., MAC-0452936) identified in E. coli induce outer membrane destabilization and bactericidal effects . These compounds could inform therapies targeting H. ducreyi.

  • Phenotypic Screening: GFP-based reporters (e.g., pPromrcsA-GFP) detect Lgt inhibition in E. coli, a method applicable to H. ducreyi studies .

Genetic and Phenotypic Studies in H. ducreyi

  • Mutant Analysis: H. ducreyi mutants lacking glycosyltransferases (e.g., lgtF) exhibit truncated LOS and reduced resistance to host defenses .

  • Immune Evasion: H. ducreyi lipoproteins inhibit phagocytosis and resist antimicrobial peptides (e.g., LL-37), mediated partly by transporters like Mtr and Sap .

Unresolved Questions and Future Directions

  • Structural Characterization: High-resolution structures of H. ducreyi Lgt are needed to define substrate-binding pockets and guide inhibitor design.

  • Resistance Mechanisms: Unlike downstream lipoprotein pathway inhibitors, Lgt inhibition may evade common resistance mechanisms (e.g., lpp deletion) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; HD_0174; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
lgt
Target Protein Sequence
MSEQFIQFPQIDPIIFSLGPISLRWYGLMYLIGFAFAYWLGMKRAKASGGVWNGEQVDQL LYTGFWGVVLGGRVGDVLFYSFDRFLQDPLFLFRIWEGGMSFHGGLIGVIVAMIWVSYRQ QRSFWQTADFIAPLIPFGLGMGRIGNFINDELWGRVTDVPWAVLFPSGGYLPRHPSQLYE FLLEGVVLFGILNAFIKKPRPMGSVAGLFLVGYGVFRFVVEYVRDIDPNVNTAADLITRG QLLSLPMIVGGVGVMLWAYRSNKAE
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: hdu:HD_0174

STRING: 233412.HD0174

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (lgt) in Haemophilus ducreyi?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in H. ducreyi and other Gram-negative bacteria that catalyzes a critical step in bacterial lipoprotein biosynthesis. The lgt enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. This post-translational modification is crucial for proper lipoprotein anchoring to the bacterial membrane. Mutations in the lgt gene are typically lethal in Gram-negative organisms like Escherichia coli, highlighting its essential role in bacterial survival . In the context of H. ducreyi research, understanding lgt function provides insights into fundamental bacterial physiology and potential targets for intervention against this pathogen.

How does H. ducreyi lgt compare structurally and functionally to lgt from other bacterial species?

While the search results don't provide specific structural comparisons of H. ducreyi lgt to other bacterial species, complementation studies suggest functional conservation. Research has demonstrated that the Vibrio cholerae-derived lgt gene can functionally complement an lgt deletion in E. coli, allowing temperature-dependent growth . This suggests conservation of essential functional domains despite potential sequence variations. Researchers investigating H. ducreyi lgt should consider:

  • Sequence alignment analysis with other characterized bacterial lgt proteins

  • Conserved active site residues across bacterial species

  • Substrate specificity differences that might exist between H. ducreyi lgt and better-characterized homologs

  • Potential structural differences that could be exploited for species-specific targeting

What is known about the genetic organization and regulation of the lgt gene in H. ducreyi?

  • Promoter regions upstream of the H. ducreyi lgt gene

  • Potential transcriptional regulators that modulate lgt expression

  • Co-transcribed genes that might functionally interact with lgt

  • Comparative genomic analysis across H. ducreyi strains to identify conserved regulatory elements

What are the optimal conditions for cloning and expressing recombinant H. ducreyi lgt in E. coli expression systems?

Based on successful approaches with other H. ducreyi proteins and related lgt systems, researchers should consider the following methodological recommendations:

  • Vector selection: Use a temperature-insensitive expression vector similar to those developed for the V. cholerae lgt system . T7-inducible promoter systems have proven effective for expressing other H. ducreyi outer membrane proteins without toxicity .

  • Expression strategy: Design primers to amplify the full-length mature H. ducreyi lgt gene without its leader sequence. Include unique restriction sites for in-frame fusion to a hexahistidine tag to facilitate purification .

  • Host strain selection: Use E. coli strains containing the λ lysogen DE3 for T7 RNA polymerase-based expression systems .

  • Induction protocol:

    • Grow cultures to an optical density (OD600) of approximately 0.5

    • Induce with IPTG (2 mM final concentration)

    • After 30 minutes, add rifampin (200 μg/ml) to inhibit host RNA polymerase

    • Continue incubation for an additional 2 hours

  • Protein purification: Isolate inclusion bodies by cell disruption using a French press, followed by centrifugation at 10,000 × g. Purify the recombinant protein under denaturing conditions using metal chelate chromatography .

How can I establish an lgt-based selection system for stable plasmid maintenance in H. ducreyi?

To establish an lgt-based selection system in H. ducreyi similar to the one described for E. coli, consider this methodological approach:

  • Generation of lgt deletion mutant:

    • Create a chromosomal deletion of the endogenous H. ducreyi lgt gene

    • Complement the deletion with the corresponding gene from another species (e.g., E. coli or V. cholerae) on a temperature-sensitive plasmid

    • The complemented strain should grow at permissive temperature (30°C) but not at restrictive temperature (37-39°C)

  • Construction of expression vector:

    • Develop a temperature-insensitive expression vector carrying the complementing lgt gene

    • Include multiple cloning sites for insertion of target genes

    • The vector should allow selection by growth at restrictive temperature without requiring antibiotic markers

  • Validation of system stability:

    • Assess plasmid retention over multiple generations without antibiotic selection

    • Compare expression levels of recombinant proteins with conventional antibiotic-based selection systems

    • Evaluate both soluble proteins and those forming inclusion bodies to ensure system versatility

What methods are most effective for analyzing the enzymatic activity of recombinant H. ducreyi lgt?

To assess the enzymatic activity of recombinant H. ducreyi lgt, researchers should consider the following methodological approaches:

  • In vitro diacylglyceryl transferase assay:

    • Use purified recombinant lgt and synthetic peptide substrates containing the lipobox motif

    • Include radiolabeled phosphatidylglycerol as the lipid donor

    • Measure transfer of the diacylglyceryl moiety to the substrate by thin-layer chromatography or mass spectrometry

  • Complementation assays:

    • Test the ability of recombinant H. ducreyi lgt to complement growth of lgt-deficient E. coli at non-permissive temperatures

    • Analysis should include growth kinetics and microscopic examination of cell morphology

  • Lipoprotein processing analysis:

    • Express a model lipoprotein in the presence and absence of functional lgt

    • Analyze changes in membrane localization and post-translational modification using mass spectrometry

    • Compare processing of the model lipoprotein by H. ducreyi lgt versus lgt from other bacterial species

How can recombinant H. ducreyi lgt be utilized in developing novel vaccination strategies against chancroid?

While the search results don't specifically address H. ducreyi lgt as a vaccine target, lessons from research on other H. ducreyi proteins provide instructive approaches:

  • Epitope identification and targeting:

    • Generate monoclonal antibodies against purified recombinant H. ducreyi lgt

    • Use peptide libraries to map the smallest nominal epitopes recognized by these antibodies

    • Focus on conserved epitopes across H. ducreyi strains

  • Animal model validation:

    • Test recombinant lgt immunization in established animal models of H. ducreyi infection

    • The swine model used for HgbA vaccine testing could be adapted for lgt evaluation

    • Assess protection by histological examination and bacterial recovery from inoculation sites

  • Functional antibody assessment:

    • Evaluate whether anti-lgt antibodies have bactericidal activity

    • Test if antibodies can inhibit lgt enzymatic function and affect bacterial viability

    • Compare antibody responses between class I and class II H. ducreyi strains

What are the methodological approaches for studying the role of lgt in H. ducreyi pathogenesis?

To investigate the role of lgt in H. ducreyi pathogenesis, researchers should consider these methodological approaches:

  • Conditional mutant construction:

    • Since lgt deletion is likely lethal, develop conditional expression systems to modulate lgt levels

    • Use temperature-sensitive complementation or inducible promoters to control expression

  • Lipoprotein profiling:

    • Compare the lipoprotein profiles of H. ducreyi under lgt-limiting conditions

    • Use proteomics approaches to identify lipoproteins dependent on lgt processing

    • Correlate changes in lipoprotein profiles with virulence phenotypes

  • Infection models:

    • Utilize human and animal models of H. ducreyi infection

    • Assess the ability of lgt-depleted H. ducreyi to initiate and maintain infection

    • Compare histological features of infection sites with wild-type bacteria

How do class I and class II H. ducreyi strains differ in lgt expression and function?

The search results indicate significant genetic and phenotypic differences between class I and class II H. ducreyi strains, particularly in outer membrane proteins like DsrA . While specific differences in lgt between these classes aren't detailed in the provided sources, researchers should consider:

  • Comparative sequence analysis:

    • Analyze lgt gene sequences from multiple class I and class II strains

    • Identify any consistent polymorphisms that might affect enzyme function

    • Examine differences in promoter regions that could influence expression levels

  • Cross-complementation studies:

    • Test whether lgt from class I strains can complement class II lgt knockouts and vice versa

    • Measure relative enzymatic activity of lgt from both classes using standardized assays

    • Assess differences in temperature sensitivity or substrate specificity

  • Lipoprotein processing comparison:

    • Identify any class-specific differences in lipoprotein profiles

    • Determine if differential lipoprotein processing contributes to known phenotypic differences between classes

    • Evaluate the role of lgt in expression of virulence factors that differ between classes

What are common challenges in purifying active recombinant H. ducreyi lgt and how can they be addressed?

Based on experiences with other H. ducreyi recombinant proteins, researchers may encounter these challenges when working with lgt:

  • Inclusion body formation:

    • When expressed at high levels, recombinant H. ducreyi membrane proteins often form inclusion bodies

    • Optimize induction conditions by testing different IPTG concentrations and lower induction temperatures

    • For refolding from inclusion bodies, use a gradual dialysis protocol to remove denaturants

  • Maintaining enzyme activity:

    • Lgt is a membrane enzyme that may require lipids for proper folding and activity

    • Consider adding phospholipids during purification and storage

    • Test activity immediately after purification as enzyme stability may be limited

  • Purification strategy optimization:

    • For metal chelate chromatography, test different metal ions (Ni², Co², Cu²⁺) for optimal binding

    • Include reducing agents to prevent oxidation of critical cysteine residues

    • Consider using mild detergents to maintain native conformation

How should researchers analyze and interpret contradictory data when comparing lgt function across different H. ducreyi strains?

When faced with contradictory data regarding lgt function across H. ducreyi strains, researchers should:

  • Assess strain verification:

    • Confirm strain identities through genetic markers specific to class I or class II H. ducreyi

    • Sequence the lgt gene from each strain to identify potential polymorphisms

    • Verify that no contamination has occurred during strain maintenance

  • Standardize experimental conditions:

    • Ensure consistent growth conditions across all strains being compared

    • Standardize protein expression and purification protocols

    • Use identical substrate concentrations and assay conditions

  • Analyze strain-specific factors:

    • Consider whether other proteins in different H. ducreyi strains might interact with lgt

    • Evaluate strain-specific post-translational modifications that might affect activity

    • Assess differences in membrane composition that could influence enzyme function

What controls should be included when assessing the specificity of anti-H. ducreyi lgt antibodies?

When developing and testing antibodies against H. ducreyi lgt, researchers should include these essential controls:

  • Genetic controls:

    • Test reactivity against an isogenic lgt knockout strain (complemented with a heterologous lgt)

    • Compare binding to H. ducreyi lgt versus lgt from related bacterial species

    • Include clinical isolates representing genetic diversity within H. ducreyi

  • Biochemical controls:

    • Test antibody binding to denatured versus native forms of the protein

    • Assess recognition of monomeric versus multimeric forms if applicable

    • Pre-absorb antibodies with purified recombinant protein to demonstrate specificity

  • Functional validation:

    • Determine whether antibodies inhibit enzymatic activity

    • Assess antibody binding under different growth conditions

    • Evaluate cross-reactivity with other bacterial proteins through Western blot analysis

What are promising approaches for targeting H. ducreyi lgt in antimicrobial development?

Given the essential nature of lgt in Gram-negative bacteria, several approaches show promise for antimicrobial development:

  • Structure-based drug design:

    • Determine the crystal structure of H. ducreyi lgt

    • Identify unique features of the active site that could be targeted selectively

    • Design small molecule inhibitors that block substrate binding or catalytic activity

  • Lipoprotein processing pathway targeting:

    • Develop combination approaches targeting multiple steps in lipoprotein processing

    • Test synergy between lgt inhibitors and other antimicrobials

    • Identify downstream effects of lgt inhibition that might heighten antimicrobial efficacy

  • Antibody-based therapeutic approaches:

    • Investigate whether anti-lgt antibodies have direct bactericidal activity

    • Develop antibody-drug conjugates targeting surface-exposed domains of lgt

    • Assess the potential for lgt inhibition to sensitize H. ducreyi to host defense mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.