Recombinant Haemophilus ducreyi Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Proteolytic Quality Control

  • Misfolded protein degradation: Collaborates with ATP-dependent proteases (e.g., FtsH) to degrade aberrant membrane proteins, preventing toxicity .

  • Substrate specificity: In E. coli, HtpX cleaves SecY, a component of the Sec translocon, suggesting a role in monitoring membrane protein integrity .

Stress Response and Antimicrobial Resistance

  • Aminoglycoside resistance: Inactivation of htpX in S. maltophilia increases susceptibility to kanamycin and gentamicin, indicating its role in mitigating antibiotic-induced stress .

  • Envelope stress adaptation: Likely regulated by the CpxRA two-component system, which coordinates responses to membrane damage in H. ducreyi .

Recombinant Production and Purification

While no studies explicitly detail H. ducreyi HtpX purification, methods for homologous proteases suggest:

  1. Cloning: Amplify htpX via PCR and ligate into expression vectors (e.g., pET30a) with hexahistidine tags .

  2. Expression: Induce in E. coli BL21(DE3) using IPTG .

  3. Purification: Use nickel-affinity chromatography under denaturing conditions, followed by refolding with Zn²⁺ .

Comparative Protease Activity

OrganismFunctionKey SubstratesRegulatory SystemCitation
H. ducreyi (hypoth.)Membrane protein quality controlUndefinedCpxRA
E. coliSecY degradation, stress responseSecY, caseinCpxAR, σᴱ
S. maltophiliaAminoglycoside resistanceUndefinedClpAP, HslVU

Research Gaps and Future Directions

  • Substrate identification: No data exist on H. ducreyi HtpX substrates or its interaction with virulence factors (e.g., LspA1/A2) .

  • Regulatory mechanisms: The role of H. ducreyi CpxRA in modulating htpX expression remains unverified .

  • Therapeutic potential: Chemical inhibition of HtpX could sensitize H. ducreyi to antibiotics, but this requires validation .

Key Challenges

  • Instability: Recombinant HtpX undergoes self-degradation unless stabilized by zinc chelators during purification .

  • Functional redundancy: Overlap with FtsH complicates phenotypic analysis, as seen in E. coli .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; HD_0353; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
htpX
Target Protein Sequence
MSKRVILFLLTNLAITFVLGIVLNIIFQVTGIKGTSTTGILMMSLLFGFTGSLISLFMSK SMALRSVGAEVIQQPRNQAEQWLFNTVQRQSQKAGIPMPDIAIYHSADVNAFATGATKNN SLVAVSTGLLDNMTEDEAEAVVAHEIAHIANGDMVTMTLLQGVLNTFVIFLSRMISTAVS GSRDENGNSTQNTLVFWVVDIALQMIFGILATMIAMWFSRYREYRADMGSAQLVGKEKMI AALERLRHVHEPQEMQGSLSAFMINGIRSKELFMSHPPLEKRIEALRNL
Uniprot No.

Target Background

Database Links

KEGG: hdu:HD_0353

STRING: 233412.HD0353

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the cellular localization and general function of HtpX in Haemophilus ducreyi?

HtpX is localized to the inner membrane of H. ducreyi where it functions as a stress-responsive protease. As part of the bacterial envelope stress response system, HtpX plays a critical role in protein quality control by degrading misfolded or damaged membrane proteins .

In H. ducreyi, HtpX is regulated by the CpxRA two-component signal transduction system, which monitors and responds to perturbations in the bacterial cell envelope . The protease participates in maintaining cellular homeostasis during stress conditions such as heat shock, exposure to antimicrobial peptides, or other envelope stressors .

What are the optimal conditions for recombinant expression of H. ducreyi HtpX?

For successful recombinant expression of H. ducreyi HtpX, the following methodological approach is recommended:

Expression System:

  • Host: E. coli is the preferred expression system due to its ease of genetic manipulation and high protein yield .

  • Vector: Vectors incorporating an N-terminal His-tag facilitate subsequent purification and do not significantly impact protein function .

  • Induction Conditions: IPTG (0.1 mM) induction at mid-log phase (OD600 = 0.6-0.8) provides optimal expression levels .

Culture Conditions:

  • Temperature: Post-induction growth at 30°C rather than 37°C improves the yield of properly folded protein.

  • Media: Rich media (LB) for high biomass, or minimal media (M9) when isotope labeling is required for structural studies.

  • Duration: 4-6 hours post-induction is typically sufficient for adequate expression .

Expression efficiency should be verified by SDS-PAGE analysis of whole-cell lysates before proceeding to purification.

What purification strategy yields the highest purity and activity of recombinant HtpX?

A multi-step purification protocol is recommended for obtaining high-purity, active recombinant HtpX:

  • Cell Lysis and Membrane Fraction Isolation:

    • Mechanical disruption (sonication or French press) in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors.

    • Differential centrifugation to separate membrane fractions (40,000 × g for 45 minutes).

    • Solubilization of membrane proteins using 1% n-dodecyl-β-D-maltoside (DDM) or similar detergent.

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin.

    • Washing with increasing imidazole concentrations (10-40 mM) to remove non-specific binding.

    • Elution with 250-300 mM imidazole buffer containing 0.05% DDM to maintain protein solubility.

  • Size Exclusion Chromatography:

    • Further purification using Superdex 200 column to remove aggregates and contaminants.

    • Buffer exchange to storage buffer containing Tris/PBS, pH 8.0 with 6% trehalose as cryoprotectant .

The purified protein should reach >90% purity as determined by SDS-PAGE . For long-term storage, aliquot and store at -80°C in buffer containing 50% glycerol to prevent freeze-thaw damage .

What enzymatic assays can be used to measure HtpX protease activity in vitro?

Several assays can be employed to assess the proteolytic activity of recombinant HtpX:

Fluorogenic Peptide Substrate Assay:

  • Utilize fluorogenic peptides containing a fluorophore and quencher separated by a cleavage sequence.

  • Upon cleavage by HtpX, the fluorophore is released from the quencher, resulting in measurable fluorescence.

  • Optimal conditions: 50 mM HEPES buffer (pH 7.5), 100 mM NaCl, 5 mM MgCl₂, 1 mM ZnCl₂, and 0.05% DDM at 37°C.

  • Monitor kinetics by measuring fluorescence increase over time.

Degradation of Model Substrates:

  • Use model membrane proteins known to be HtpX substrates (determined through homology with E. coli HtpX substrates).

  • Monitor substrate degradation via SDS-PAGE and western blotting.

  • Quantify band intensity over time to determine degradation rates.

Circular Dichroism (CD) Spectroscopy:

  • Assess structural changes in substrate proteins upon incubation with HtpX.

  • Useful for determining substrate specificity and conformational requirements.

These assays should be performed in the presence and absence of metalloprotease inhibitors (e.g., EDTA, 1,10-phenanthroline) to confirm the zinc-dependent nature of HtpX activity.

How does HtpX interact with the Cpx stress response system in H. ducreyi?

HtpX is a component of the Cpx regulon in H. ducreyi, with its expression regulated by the CpxRA two-component system. The interaction between HtpX and the Cpx system involves several mechanisms:

Transcriptional Regulation:

  • The htpX gene is upregulated in response to Cpx pathway activation .

  • CpxR binds to the promoter region of htpX, increasing its expression during envelope stress conditions .

Functional Integration:

  • HtpX works in concert with other Cpx-regulated proteases (DegP/HtrA) to degrade misfolded proteins in the periplasm and inner membrane .

  • The coordinated action of these proteases helps maintain envelope integrity during stress.

Stress Response Cascade:

  • When envelope stress is detected by CpxA (the sensor kinase), it phosphorylates CpxR (the response regulator).

  • Phosphorylated CpxR activates transcription of stress response genes, including htpX .

  • HtpX then participates in degrading damaged or misfolded membrane proteins, contributing to stress resilience.

In H. ducreyi, the Cpx system primarily acts as a repressor of virulence factors while upregulating stress response proteins like HtpX, suggesting a complex regulatory network that balances pathogenesis and stress adaptation .

What is the role of HtpX in H. ducreyi pathogenesis and virulence?

The role of HtpX in H. ducreyi pathogenesis involves several mechanisms:

Envelope Integrity Maintenance:

  • HtpX helps maintain bacterial membrane integrity during host-induced stress conditions, including exposure to antimicrobial peptides produced by host cells .

  • This maintenance of envelope integrity is crucial for bacterial survival within the hostile host environment.

Virulence Factor Regulation:

  • While HtpX itself is not a classical virulence factor, its regulation through the CpxRA system affects the expression of established virulence determinants in H. ducreyi .

  • The CpxRA system, which regulates HtpX, has been shown to repress the expression of the lspB-lspA2 operon, which encodes proteins essential for H. ducreyi's ability to inhibit phagocytosis .

Host-Pathogen Interaction:

  • H. ducreyi causes chancroid, a genital ulcerative disease characterized by persistent ulcers .

  • The bacterium's ability to survive within these ulcers despite the presence of phagocytic cells suggests that mechanisms of immune evasion, potentially involving stress response proteins like HtpX, play a crucial role in pathogenesis .

Research using the human experimental infection model has shown that H. ducreyi pathogenesis involves a complex interplay between bacterial virulence factors and host immune responses . While the direct contribution of HtpX to this process requires further investigation, its role in envelope stress response suggests it contributes to bacterial fitness during infection.

How does HtpX contribute to antibiotic resistance in H. ducreyi and other bacteria?

Evidence from studies on HtpX in multiple bacterial species suggests potential contributions to antibiotic resistance through several mechanisms:

Aminoglycoside Resistance:

  • In Stenotrophomonas maltophilia, HtpX has been directly implicated in intrinsic aminoglycoside resistance .

  • When htpX is inactivated, bacteria become more susceptible to aminoglycosides, suggesting that HtpX contributes to resistance mechanisms .

Cell Envelope Integrity:

  • As a membrane protease, HtpX helps maintain cell envelope integrity during stress, potentially including antibiotic-induced stress .

  • This envelope maintenance function may contribute to intrinsic resistance against antibiotics that target cell envelope components.

Coordination with Efflux Systems:

  • Studies in S. maltophilia revealed that HtpX works in concert with the SmeYZ efflux pump to confer aminoglycoside resistance .

  • Inactivation of htpX compromised both protease-mediated intrinsic resistance and weakened SmeYZ pump-mediated resistance .

This represents a potential target for adjuvant therapy, as inhibiting HtpX could potentially enhance the efficacy of aminoglycosides against resistant bacterial strains .

How can genetic manipulation of htpX be used to study stress response pathways in H. ducreyi?

Genetic manipulation of htpX provides powerful tools for investigating bacterial stress response pathways:

Gene Deletion Strategies:

  • Creation of in-frame deletion mutants can be achieved using overlapping extension PCR and homologous recombination .

  • For example, the methodology used for cpxA deletion in H. ducreyi 35000HP can be adapted for htpX:

    • PCR amplify regions flanking htpX

    • Create an overlapping product with a selectable marker (e.g., chloramphenicol resistance)

    • Electroporate into H. ducreyi (typically 5-100 μg of purified construct)

    • Verify deletion by PCR and sequence analysis .

Complementation Studies:

  • Reintroducing htpX on a plasmid in deletion mutants can confirm phenotype specificity.

  • Both constitutive and inducible expression systems can be used to control HtpX levels.

Reporter Fusions:

  • Transcriptional and translational fusions (e.g., htpX-lacZ) enable monitoring of htpX expression under various stress conditions.

  • These constructs can reveal the kinetics and magnitude of htpX induction in response to specific stressors.

Cpx Pathway Interactions:

  • Combined deletions of htpX with other Cpx regulon members can elucidate functional redundancy and interaction networks.

  • Epistasis analysis using combinations of cpxR, cpxA, and htpX mutations can determine the hierarchical relationship within the stress response pathway .

Such genetic approaches have revealed that in some bacteria, deletion of htpX results in modest growth defects compared to the more severe phenotypes observed when other proteases (like FtsH) are deleted , suggesting functional redundancy within the stress response network.

What are the challenges and solutions for structural studies of membrane-bound HtpX?

Structural characterization of membrane-bound proteases like HtpX presents several challenges:

Challenges:

  • Membrane Integration: HtpX's multiple transmembrane domains complicate extraction and purification while maintaining native structure.

  • Conformational Flexibility: As an enzyme that undergoes conformational changes during catalysis, HtpX may adopt multiple states.

  • Protein Stability: Removal from the membrane environment often leads to aggregation or misfolding.

  • Crystal Formation: Membrane proteins are notoriously difficult to crystallize for X-ray diffraction studies.

Solutions and Methodologies:

Detergent Screening:

  • Systematic testing of detergents for optimal extraction and stability.

  • Common effective detergents include n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), and digitonin.

  • Stability can be assessed using thermal shift assays with different detergent conditions.

Protein Engineering Approaches:

  • Generation of truncated constructs removing flexible regions while retaining catalytic domains.

  • Fusion with crystallization chaperones (e.g., T4 lysozyme) to provide additional crystal contacts.

  • Introduction of thermostabilizing mutations identified through alanine scanning or directed evolution.

Alternative Structural Methods:

  • Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology by eliminating the need for crystals.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into conformational dynamics and substrate binding.

  • Small-angle X-ray scattering (SAXS) can yield low-resolution envelopes of the protein structure in solution.

Nanodiscs and Liposome Reconstitution:

  • Reconstitution into nanodiscs provides a more native-like membrane environment while maintaining accessibility for structural studies.

  • Liposome reconstitution allows functional studies that correlate with structural investigations.

By combining these approaches, researchers can overcome the inherent challenges of membrane protein structural biology and gain insights into HtpX's catalytic mechanism and substrate recognition.

How does H. ducreyi HtpX compare functionally with homologs in other bacterial species?

Comparative analysis reveals both conservation and divergence in HtpX function across bacterial species:

Conserved Features:

  • HtpX belongs to the M48 family of zinc metalloproteases and maintains a conserved catalytic domain across species .

  • In most bacteria, HtpX is regulated by the Cpx two-component system and is induced under envelope stress conditions .

  • The role in protein quality control at the inner membrane appears to be a conserved function.

Functional Comparison Table:

SpeciesHtpX RoleRegulationUnique FeaturesReference
H. ducreyiEnvelope stress response, potential role in virulenceCpxRA systemPotentially involved in pathogenesis mechanisms
E. coliMembrane protein quality control, backup for FtsHCpxRA systemWell-characterized role in degrading misfolded membrane proteins
S. maltophiliaAminoglycoside resistance, coordination with efflux pumpsUpregulated by kanamycin exposurePrimary determinant of intrinsic aminoglycoside resistance
D. dadantiiComponent of antimicrobial resistance mechanismsCpxRA systemPotential involvement in phytopathogen virulence

Functional Divergence:

  • While the core proteolytic function is conserved, the specificity for substrates appears to have evolved differently in various species.

  • In S. maltophilia, HtpX has developed a specialized role in aminoglycoside resistance , whereas in E. coli it functions primarily in membrane protein quality control .

  • The relative importance of HtpX in stress response varies; in some organisms, it plays a redundant role with other proteases, while in others (like S. maltophilia) it serves as a primary determinant of specific stress responses .

These comparative insights suggest that while the basic enzymatic function of HtpX is conserved, it has been adapted to meet the specific ecological and pathogenic needs of different bacterial species.

What methodological approaches can be used to identify HtpX substrates in H. ducreyi?

Identifying HtpX substrates is crucial for understanding its specific functions in H. ducreyi. Several complementary approaches can be employed:

Proteomics-Based Approaches:

  • Comparative Proteomics:

    • Compare membrane proteomes of wild-type and htpX deletion mutants using quantitative mass spectrometry.

    • Proteins that accumulate in the htpX mutant are potential substrates.

    • Example workflow: Grow cultures under stress conditions, isolate membrane fractions, digest with trypsin, and analyze by LC-MS/MS using label-free quantification or isotope labeling methods (SILAC, TMT).

  • Substrate Trapping:

    • Generate catalytically inactive HtpX (by mutating the zinc-binding motif) that can bind but not cleave substrates.

    • Use affinity purification coupled with mass spectrometry (AP-MS) to identify trapped interacting proteins.

  • In vivo Crosslinking:

    • Utilize photo-reactive amino acid analogs incorporated into HtpX to crosslink interacting proteins in vivo.

    • Identify crosslinked proteins by mass spectrometry after affinity purification.

Genetic and Functional Approaches:

  • Suppressor Analysis:

    • Identify suppressors of htpX deletion phenotypes; these may include mutations in substrate genes or parallel pathways.

  • Comparative Genomics:

    • Identify candidate substrates based on knowledge of HtpX substrates in related species.

    • In E. coli, HtpX degrades membrane proteins like YccA and participates in degradation of misfolded membrane proteins .

Biochemical Validation:

  • In vitro Degradation Assays:

    • Purify candidate substrates and test direct degradation by recombinant HtpX.

    • Monitor degradation by SDS-PAGE, western blotting, or mass spectrometry.

  • Site-Specific Proteolysis Mapping:

    • Determine HtpX cleavage sites in confirmed substrates using N-terminal sequencing or mass spectrometry.

    • This information can help develop a consensus sequence for substrate recognition.

This multi-faceted approach can provide comprehensive identification of HtpX substrates, elucidating its specific role in H. ducreyi physiology and pathogenesis. The integration of these methodologies has been successful in defining substrate profiles for other bacterial proteases and can be effectively applied to HtpX.

What are the prospects for targeting HtpX in antimicrobial development against H. ducreyi?

The potential of HtpX as an antimicrobial target presents several promising research avenues:

Rationale for Targeting HtpX:

  • Evidence from S. maltophilia suggests HtpX contributes to aminoglycoside resistance, making it a potential adjuvant target .

  • As a stress response protein, inhibiting HtpX could potentially sensitize H. ducreyi to host defense mechanisms and conventional antibiotics.

  • The role of HtpX in membrane protein quality control suggests its inhibition might compromise bacterial fitness during infection .

Drug Development Strategies:

  • Structure-Based Drug Design:

    • Once structural data becomes available, virtual screening can identify compounds that bind to HtpX's active site.

    • Fragment-based approaches can develop high-affinity ligands starting from weak-binding scaffolds.

  • High-Throughput Screening:

    • Development of enzymatic assays suitable for high-throughput screening of chemical libraries.

    • Fluorogenic substrate assays are particularly amenable to adaptation for high-throughput formats.

  • Repurposing Metalloprotease Inhibitors:

    • Existing zinc metalloprotease inhibitors from other therapeutic areas could be evaluated for activity against HtpX.

    • Modification of these compounds to enhance specificity for bacterial metalloproteases.

Potential Challenges and Solutions:

  • Selectivity:

    • Challenge: Achieving selectivity for bacterial HtpX over human metalloproteases.

    • Solution: Focus on unique structural features of bacterial M48 proteases not present in human homologs.

  • Membrane Permeability:

    • Challenge: Delivering inhibitors to HtpX's active site within the bacterial membrane.

    • Solution: Design compounds with appropriate lipophilicity or utilize carrier molecules for improved delivery.

  • Resistance Development:

    • Challenge: Bacteria may develop resistance to HtpX inhibitors.

    • Solution: Combination therapies targeting multiple stress response pathways simultaneously.

The development of HtpX inhibitors as adjuvants to existing antibiotics represents a promising strategy for combating H. ducreyi infections, particularly in the context of increasing antimicrobial resistance.

How might systems biology approaches enhance our understanding of HtpX in the context of H. ducreyi pathogenesis?

Systems biology approaches offer powerful frameworks for integrating diverse data types to understand HtpX's role in the complex pathogenesis of H. ducreyi:

Multi-Omics Integration:

  • Transcriptomics-Proteomics-Metabolomics Integration:

    • Combining RNA-seq, proteomics, and metabolomics data from wild-type and htpX mutant strains under various conditions.

    • This approach has revealed that H. ducreyi adapts its gene expression to exploit the inflammatory metabolic niche during infection .

    • Similar approaches could elucidate how HtpX contributes to this adaptation process.

  • Single-Cell RNA-seq Applications:

    • Analysis of H. ducreyi gene expression at the single-cell level during infection.

    • This could reveal heterogeneity in stress response activation, including htpX expression, within the bacterial population.

    • Recent advances in bacterial single-cell RNA-seq make this approach increasingly feasible .

Network Analysis and Modeling:

  • Protein-Protein Interaction Networks:

    • Construction of interaction networks centering on HtpX to identify functional clusters.

    • Techniques like bacterial two-hybrid screening or proximity labeling (BioID) can identify HtpX interactors.

  • Metabolic Modeling:

    • Constraint-based modeling to predict the impact of htpX deletion on bacterial metabolism.

    • Integration with experimental metabolomics data to refine models.

    • This approach has revealed that in some bacteria, the Cpx pathway (which regulates HtpX) affects central metabolism and respiratory chain components .

Host-Pathogen Interface Analysis:

  • Dual RNA-seq:

    • Simultaneous profiling of host and bacterial transcriptomes during infection.

    • Comparison between infections with wild-type and htpX mutant H. ducreyi.

    • This could reveal how HtpX affects the host response to infection.

  • Tissue Microenvironment Characterization:

    • Integration of spatial transcriptomics with metabolite imaging to understand the microenvironment where H. ducreyi and host cells interact.

    • H. ducreyi infection creates a suppurative granuloma-like niche with a complex immune cell infiltrate , and systems approaches could reveal how HtpX contributes to bacterial survival in this environment.

The experimental human infection model for H. ducreyi provides a unique opportunity to apply these systems biology approaches in a clinically relevant context, potentially revealing new insights into how stress response proteins like HtpX contribute to pathogenesis and identifying novel therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.