Recombinant Haemophilus ducreyi UPF0208 membrane protein HD_1715 (HD_1715)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HD_1715; UPF0208 membrane protein HD_1715
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Target Names
HD_1715
Target Protein Sequence
MRSIMINTIQLGQRYLETYPNQKKLALFMPDYRLIRLVKQAARFMPIFACFAILWQYFFT DPTQSILANAIITSLFAISLPYQGLYWLGKRANTPLPLSLLDWYQSLKQKLISEQKIMQD QAVPSYQDFANLLKLAEETWGDNYFNEL
Uniprot No.

Target Background

Database Links

KEGG: hdu:HD_1715

STRING: 233412.HD1715

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Haemophilus ducreyi UPF0208 membrane protein HD_1715?

    HD_1715 is a membrane protein from the pathogenic bacterium Haemophilus ducreyi strain 35000HP/ATCC 700724, which causes chancroid (a sexually transmitted disease producing genital ulcers) and non-genital cutaneous ulcers in children, particularly in low/middle-income countries of the South Pacific Islands and West Africa . The protein belongs to the UPF0208 family of membrane proteins, has a UniProt ID of Q7VKY8, and consists of 148 amino acids . While the exact function of HD_1715 remains under investigation, studying this protein may provide insights into H. ducreyi pathogenicity mechanisms.

  • What expression systems are recommended for recombinant HD_1715 production?

    Several expression systems have been validated for recombinant HD_1715 production:

    Expression SystemAdvantagesConsiderations
    E. coliHigh yield, cost-effective, rapid expressionMay require optimization for membrane protein folding
    YeastBetter for eukaryotic-like post-translational modificationsLonger expression time than E. coli
    BaculovirusExcellent for complex proteins, high-yieldMore technical expertise required
    Mammalian cellsNative-like folding and modificationsLower yield, higher cost

    For initial characterization studies, E. coli expression systems like DH5α have been successfully used for similar membrane proteins . For structural studies requiring proper folding, mammalian or baculovirus systems may be preferable .

  • How should recombinant HD_1715 be stored and handled?

    Based on established protocols for similar membrane proteins, it is recommended to:

    • Store lyophilized protein at -20°C to -80°C

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    These conditions minimize protein degradation and maintain functional integrity for experimental use.

  • What are the basic structural characteristics of HD_1715?

    HD_1715 exhibits characteristics typical of transmembrane proteins:

    • Contains hydrophobic regions consistent with membrane spanning domains

    • Includes charged residues likely positioned at membrane interfaces

    • Belongs to the UPF0208 family of membrane proteins with unknown function

    • Has a predicted molecular weight of approximately 16-17 kDa

    • Contains multiple hydrophobic regions (FPIFACFAILWQY and SILANAIITSLFAISL) suggesting transmembrane helices

    Preliminary structural analysis suggests HD_1715 may have multiple membrane-spanning regions, though detailed 3D structural studies have not yet been published.

Advanced Research Questions

  • What experimental approaches are most effective for studying the function of HD_1715 in Haemophilus ducreyi pathogenicity?

    Based on successful strategies used with other H. ducreyi virulence factors, a multi-faceted approach is recommended:

    1. Gene knockout studies: Create isogenic mutants lacking HD_1715 and assess changes in virulence using established infection models. This approach was successful in identifying the role of the cdtABC gene cluster in H. ducreyi cytotoxicity .

    2. Protein interaction studies: Identify binding partners using techniques such as:

      • Pull-down assays with recombinant tagged HD_1715

      • Yeast two-hybrid screening

      • Crosslinking studies followed by mass spectrometry

    3. Localization studies: Use fluorescently tagged HD_1715 to determine its cellular location during infection, similar to GFP-tagging approaches used in H. ducreyi transmission studies .

    4. Functional complementation: Express HD_1715 in heterologous systems to assess its ability to confer specific phenotypes.

    5. Antibody development: Generate monoclonal antibodies against HD_1715 to neutralize potential functions, similar to approaches used with CdtC protein in H. ducreyi .

  • How can researchers design experiments to elucidate the role of HD_1715 in host-pathogen interactions?

    A systematic experimental design approach should include:

    1. Define variables precisely:

      • Independent variables: HD_1715 expression levels, mutations, or presence/absence

      • Dependent variables: Host cell responses (adhesion, invasion, cytotoxicity)

      • Control variables: Cell types, incubation conditions, bacterial loads

    2. Develop testable hypotheses: For example, "HD_1715 contributes to H. ducreyi adherence to human keratinocytes" or "HD_1715 is required for bacterial survival within macrophages"

    3. Design controlled experiments:

      • Compare wild-type versus HD_1715 knockout strains

      • Use complemented mutants to confirm phenotypes

      • Include appropriate positive and negative controls

    4. Establish infection models:

      • Human cell culture systems (keratinocytes, fibroblasts, immune cells)

      • Ex vivo human skin models

      • Animal models where appropriate

    5. Analyze host responses:

      • Transcriptomic and proteomic changes in infected cells

      • Cytokine production and inflammatory responses

      • Cell death mechanisms

  • What analytical techniques are most effective for characterizing HD_1715 membrane topology?

    Several complementary techniques provide comprehensive topology mapping:

    1. Mass photometry: Provides single-molecule resolution of membrane protein complexes in nanodiscs, allowing determination of oligomeric state and complex formation. This technique has successfully differentiated properly assembled membrane protein complexes from misfolded variants .

    2. Cysteine scanning mutagenesis: Systematically replace residues with cysteine and use membrane-impermeable labeling reagents to determine accessibility.

    3. Protease protection assays: Expose membrane vesicles to proteases; protected fragments indicate transmembrane regions.

    4. Cryo-electron microscopy: For high-resolution structural analysis of purified HD_1715 in lipid nanodiscs or detergent micelles .

    5. Computational prediction tools: Use programs like TMHMM, Phobius, and TOPCONS to predict transmembrane regions as starting points for experimental validation.

    When using these techniques, researchers should prepare comprehensive data tables following standard formatting guidelines:

    TechniqueResolutionSample RequirementsAdvantagesLimitations
    Mass PhotometrySingle molecule50-100 μL at 10-100 nMNo labeling required, rapidLimited structural detail
    Cysteine ScanningAmino acid levelPurified protein, multiple mutantsHigh resolution topologyLabor intensive
    Cryo-EMNear-atomic3-5 mg/mL protein, high purity3D structureComplex sample preparation
    Protease ProtectionDomain levelMembrane vesiclesSimple setupLow resolution
    ComputationalSequence levelAmino acid sequenceRapid, no experimentsRequires validation
  • How can researchers effectively design mutational studies to identify critical functional domains in HD_1715?

    A systematic approach to mutational analysis should include:

    1. Sequence-guided targeting:

      • Perform multiple sequence alignment with UPF0208 family proteins

      • Identify conserved residues or motifs likely critical for function

      • Target hydrophobic regions potentially involved in membrane interactions

      • Focus on charged residues that may participate in protein-protein interactions

    2. Structure-guided targeting (if structural data becomes available):

      • Focus on surface-exposed residues

      • Target potential binding pockets or interfaces

      • Modify membrane-spanning regions

    3. Experimental design considerations:

      • Create alanine-scanning libraries across the entire protein

      • Generate domain-swap chimeras with related proteins

      • Design deletion mutants of specific regions

      • Use site-directed mutagenesis for specific residues

    4. Functional validation:

      • Express mutant proteins in H. ducreyi HD_1715 knockout strains

      • Assess complementation of phenotypes

      • Perform protein interaction studies with wild-type vs. mutant proteins

      • Evaluate membrane localization of mutant proteins

    5. Data analysis and presentation:

      • Create comprehensive mutation tables showing:

        • Mutation position

        • Amino acid change

        • Effect on expression

        • Effect on localization

        • Effect on function

        • Effect on protein interactions

  • What methods are recommended for optimizing solubilization and purification of recombinant HD_1715?

    Membrane protein purification requires specific considerations:

    1. Detergent screening:

      • Test multiple detergent classes: maltoside (DDM, UDM), glucoside (OG), fos-choline, and CHAPS

      • Evaluate mild detergents first for retaining native structure

      • Assess protein stability in each detergent using size-exclusion chromatography

    2. Solubilization optimization:

      • Test various detergent concentrations (1-5× CMC)

      • Optimize temperature (4°C vs. room temperature)

      • Evaluate solubilization time (1-24 hours)

      • Test additives: glycerol, salt concentrations, and stabilizing lipids

    3. Purification strategy:

      • Affinity chromatography using His-tag or other fusion tags

      • Size-exclusion chromatography to isolate properly folded protein

      • Ion-exchange chromatography as needed for additional purity

    4. Quality assessment:

      • SDS-PAGE for purity (>90% recommended)

      • Western blotting for identity confirmation

      • Mass spectrometry for mass verification

      • Circular dichroism for secondary structure analysis

    5. Alternative approaches:

      • Nanodisc reconstitution for enhanced stability

      • Amphipol exchange for detergent-free handling

      • Styrene maleic acid lipid particles (SMALPs) for native lipid environment preservation

  • How can researchers analyze and present experimental data related to HD_1715 function?

    Data presentation should follow scientific best practices:

    1. Data table design principles :

      • Include clear, descriptive titles

      • Label all columns with units

      • Present raw data alongside processed data

      • Include statistical analyses where appropriate

      • Use consistent decimal places

      • Organize information logically

    2. Example data table format for HD_1715 functional studies:

      Experimental ConditionProtein Expression Level (μg/mL)Membrane Localization (% of total)Binding Affinity to Target (Kd, nM)Functional Activity (% of WT)
      Wild-type HD_1715125 ± 1578 ± 545 ± 8100 ± 0
      HD_1715 R25A mutant118 ± 1275 ± 6120 ± 1565 ± 8
      HD_1715 F36A mutant130 ± 1840 ± 8250 ± 3025 ± 5
      HD_1715 W45A mutant95 ± 1080 ± 4No binding detected5 ± 2
      Negative control00No binding detected0 ± 0
    3. Figure preparation guidelines:

      • Choose appropriate visualization for data type

      • Include error bars representing standard deviation or SEM

      • Use consistent formatting and color schemes

      • Provide clear, informative legends

    4. Statistical analysis recommendations:

      • Select appropriate statistical tests based on data distribution

      • Report p-values and confidence intervals

      • Use multi-factor analysis when examining complex interactions

      • Consider power analysis for determining sample sizes

  • What are the challenges in studying potential interactions between HD_1715 and the host immune system?

    Investigating host-pathogen interactions presents several challenges:

    1. Experimental model selection:

      • In vitro cell culture systems may not recapitulate complex tissue environments

      • Animal models may not fully represent human pathology

      • Human volunteer studies present ethical limitations

    2. Technical approaches:

      • Co-immunoprecipitation with host cell lysates

      • Pull-down assays with recombinant HD_1715

      • Yeast two-hybrid screening against human cDNA libraries

      • Protein microarrays to identify binding partners

      • Mass spectrometry to identify interacting proteins

    3. Functional validation strategies:

      • Knockdown studies of identified host targets

      • Blocking studies using antibodies or peptides

      • Site-directed mutagenesis to disrupt interaction interfaces

      • Live-cell imaging to visualize interactions

    4. Data interpretation considerations:

      • Distinguish direct versus indirect interactions

      • Confirm biological relevance of observed interactions

      • Consider concentration-dependent effects

      • Validate findings using multiple techniques

    5. Relevance to infection models:

      • Correlate molecular findings with infection outcomes

      • Test hypotheses in relevant cell types (e.g., keratinocytes for cutaneous infections)

      • Consider temporal dynamics of interactions during infection progression

  • What insights can be gained from comparing HD_1715 with virulence factors from related pathogens?

    Comparative analysis provides valuable context:

    1. Phylogenetic analysis:

      • Compare HD_1715 with homologs in related Pasteurellaceae family members

      • Identify conserved regions suggesting functional importance

      • Analyze evolutionary patterns (selection pressure, conservation)

    2. Structure-function correlation:

      • Compare predicted topology with characterized membrane proteins

      • Map functional domains based on homology

      • Identify potential shared mechanisms

    3. Expression pattern analysis:

      • Compare expression regulation during infection

      • Identify common environmental triggers

      • Determine if expression coincides with other virulence factors

    4. Functional parallels:

      • Compare with other membrane proteins involved in adhesion

      • Evaluate potential roles in immune evasion

      • Assess contribution to antibiotic resistance

    5. Experimental approach:

      • Generate chimeric proteins with homologs from related species

      • Test complementation of knockout mutants across species

      • Evaluate cross-reactivity of antibodies against homologs

    This comparative approach may reveal evolutionary conservation patterns suggesting functional significance and provide insights into common virulence mechanisms across related pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.