Recombinant Haemophilus influenzae Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Haemophilus influenzae Apolipoprotein N-acyltransferase (Lnt)

Recombinant Haemophilus influenzae Lnt is a bacterial enzyme responsible for adding a third acyl chain to the N-terminal cysteine of diacylated lipoproteins, converting them into triacylated forms. This modification is critical for structural stability, membrane localization, and immune recognition in Gram-negative bacteria. While Lnt is essential in many pathogens (e.g., Helicobacter pylori), its role in H. influenzae has been explored primarily in heterologous expression systems to study lipoprotein biogenesis and vaccine development .

Expression and Production of Recombinant H. influenzae Lnt

Recombinant Lnt is typically expressed in Escherichia coli to acylate co-expressed lipoproteins, such as the outer membrane protein OMP26 from H. influenzae. Key methodologies include:

StrategyPurposeOutcome
Co-expression with OMP26Add triacylation to diacylated OMP26Enhanced triacylation efficiency
Use of Lnt-rich E. coliIncrease acylation activityPredominantly triacylated OMP26 produced
High-copy plasmid systemsBoost Lnt production for robust acylationImproved yield of lipidated proteins

These approaches enable controlled lipidation states, which are critical for studying immune responses .

Functional Studies and Lipidation-Dependent Properties

Lnt’s enzymatic activity directly impacts lipoprotein function and host-pathogen interactions:

Role in Lipoprotein Maturation

  • Diacylation: Initial lipidation occurs via Lgt (diacylglycerol transferase) .

  • Triacylation: Lnt adds a third acyl chain from phosphatidylethanolamine, enhancing membrane anchoring .

  • Immune Recognition: Triacylated lipoproteins are recognized by TLR2-TLR1/TLR6 heterodimers, while diacylated forms activate TLR2-TLR6 more potently .

Comparative Analysis of Lipidation States

PropertyDiacylated OMP26Triacylated OMP26
TLR2-TLR6 ActivationHighLow
Adaptive Immune ResponseStrongerWeaker
Bacterial Membrane StabilityModerateHigher

Data from OMP26 studies in E. coli suggest that lipidation state modulates immunogenicity .

Applications in Vaccine Development

Recombinant H. influenzae Lnt is pivotal in engineering vaccine candidates:

Vaccine CandidateLipidation StateImmune ResponseSource
OMP26 (native)Non-lipidatedMinimal TLR2 activation
OMP26 (diacylated)DiacylatedStrong TLR2-TLR6 signaling
OMP26 (triacylated)TriacylatedReduced TLR2-TLR6 activation
L-OMP26φNL-P6 fusionPredominantly diacylatedEnhanced adaptive immunity

Triacylated OMP26 shows reduced immunogenicity, whereas diacylated forms stimulate robust immune responses, making them preferable for vaccine development .

Cross-Species Insights and Essentiality

While H. pylori requires Lnt for colonization , Francisella tularensis and Neisseria gonorrhoeae exhibit Lnt-independent lipoprotein sorting via modified Lol systems . In H. influenzae, Lnt’s essentiality remains unstudied, but its recombinant application highlights its versatility in biotechnological lipidation control.

Table 1: Lipidation and Immune Response Correlation

Lipidation StateTLR2-TLR6 ActivationAdaptive ImmunityBacterial Membrane Stability
DiacylatedHighStrongModerate
TriacylatedLowWeakHigh

Table 2: Lnt Essentiality Across Bacteria

BacteriaLnt EssentialityReasonSource
H. pyloriYesColonization failure without Lnt
F. tularensisNoLol system sorts diacylated lipoproteins
H. influenzaeNot studiedRecombinant Lnt used for protein lipidation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your desired tag.
Synonyms
lnt; cutE; HI_0302; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
lnt
Target Protein Sequence
MKNLNRILLSIKFMNKYFTYLIAIISGLLGVFAFSPFDYWPLAYVSLLGLLYVAKNPKKS TALLSTFLWAMGFFCFGVSWLNVSIHQFGGASLGVSYFLVGLLAAYLALYPMLFTYLVHH FKVQSAVIFAVIWTLTEFLRGWIFTGFPWLQFGYTQIDSPFYGIAPIFGVTGLTFFTVWA SAVIFNLVSSLFKTKNLKLVLANALLLIIVGGLSAYSSRIHFVKSVEDKAISVTLAQGNI EQNLKWDPNYFYSTLAIYQKLITENLGKTDLIILPESALPTLENAITPFFEGLERAAKET KTEIMVGTVFQDTKSGKLLNSIMTAGNPDFPYQPNTQNRYNKHHLVPFGEYVPLESILRP LNSVFNLPMSAFQSGEAVQPSLIAKKRAFSPAICYEIIFGEQVRQNLKQDTDYLLTLSND AWFGDSIGPWQHLQMARMRALELGKPLIRATNTGISVFVDAQGKVLAQAPQFIETTLTYK IAPAEGKTPYSVLGNMPLYALSLLFLLLHSMMAFIRRKMNIL
Uniprot No.

Target Background

Function
Recombinant Haemophilus influenzae Apolipoprotein N-acyltransferase (lnt) catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links

KEGG: hin:HI0302

STRING: 71421.HI0302

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of apolipoprotein N-acyltransferase (lnt) in Haemophilus influenzae?

Apolipoprotein N-acyltransferase (lnt) in Haemophilus influenzae is primarily responsible for the final step in lipoprotein maturation, specifically catalyzing the N-acylation of lipoproteins. This enzyme converts diacylated apolipoprotein intermediates to triacylated mature lipoproteins by adding a third acyl chain to the N-terminal cysteine residue of prolipoproteins. The process is critical for proper lipoprotein structure and function, which in turn affects bacterial membrane integrity, transport systems, and interactions with host immune responses. Similar functional characteristics have been observed in related bacterial species, where deletion of lnt results in the production of diacylated instead of triacylated lipoproteins .

How does the structure of Haemophilus influenzae lnt compare to that of other Gram-negative bacteria?

The structural characteristics of Haemophilus influenzae lnt share significant homology with other Gram-negative bacterial lnt enzymes, particularly those of related respiratory pathogens. While the search results don't provide specific structural data for H. influenzae lnt, comparative analyses with other bacterial species indicate conserved functional domains essential for catalytic activity. In bacterial species where lnt has been characterized, it typically functions as a membrane-bound enzyme with multiple transmembrane domains and catalytic residues positioned to access both the periplasmic and membrane environments. The structural conservation of lnt across Gram-negative bacteria suggests fundamental similarities in H. influenzae, though species-specific variations likely exist to accommodate differences in lipoprotein repertoires and membrane compositions .

What experimental methods are used to detect lnt activity in Haemophilus influenzae?

Detection of lnt activity in Haemophilus influenzae can be accomplished through several complementary experimental approaches. A primary method involves mobility shift assays using SDS-PAGE followed by immunoblotting with antibodies specific to lipoproteins. As demonstrated in similar systems, lipoproteins from wild-type bacteria typically show slower migration compared to those from Δlnt mutants due to the presence of the third acyl chain. This difference in mobility serves as a reliable indicator of lnt activity . Other methodologies include mass spectrometry-based approaches to directly analyze lipoprotein acylation patterns, genetic complementation studies using tagged lipoproteins to assess processing differences, and functional assays measuring downstream effects of proper lipoprotein maturation. For instance, researchers have used reporter constructs with C-terminal tags to monitor changes in lipoprotein processing while preserving the ability to detect the proteins via immunoblotting .

What is the relationship between lnt activity and Toll-like receptor 2 (TLR2) signaling in the immune response to Haemophilus influenzae?

The relationship between lnt activity and Toll-like receptor 2 (TLR2) signaling is fundamental to understanding host-pathogen interactions during Haemophilus influenzae infection. TLR2 is a pattern recognition receptor that specifically recognizes bacterial lipoproteins, with the number of acyl chains critically influencing recognition efficiency and subsequent signaling intensity. In bacterial species where lnt has been studied, its activity directly determines whether lipoproteins are triacylated (with lnt) or diacylated (without lnt) . This distinction is crucial because triacylated and diacylated lipoproteins interact differently with TLR2 and its co-receptors (TLR1 or TLR6). Specifically, triacylated lipoproteins typically interact with TLR2/TLR1 heterodimers, while diacylated lipoproteins preferentially signal through TLR2/TLR6 complexes. These different receptor engagements trigger distinct downstream signaling cascades, altering the profile of inflammatory cytokines and chemokines produced. Research in H. pylori has demonstrated that "the absence of lnt leads to diacylated lipoproteins instead of triacyl lipoproteins... This alteration in the number of acyl chains is expected to impact the mammalian TLR2 response" . For H. influenzae researchers, understanding this relationship is critical for developing immunomodulatory strategies and evaluating lnt as a potential therapeutic target .

What are the structural and functional consequences of lnt mutation or inhibition on Haemophilus influenzae lipoproteins?

Mutation or inhibition of lnt in Haemophilus influenzae would have cascading effects on lipoprotein structure and function, impacting multiple bacterial processes. At the molecular level, the primary consequence would be the accumulation of diacylated rather than triacylated lipoproteins, as observed in other bacterial species with lnt deficiency . This alteration in acylation pattern significantly affects lipoprotein membrane anchoring and topology. Studies in related systems have demonstrated that when lipoproteins from Δlnt mutants are analyzed by SDS-PAGE, they exhibit faster mobility compared to their wild-type counterparts, consistent with a reduction in molecular weight due to the absence of the third acyl chain . Functionally, these structural changes would likely impair proper localization and function of numerous lipoproteins involved in essential processes including nutrient transport, membrane integrity, cell division, and stress responses. For example, lipoproteins involved in the Lol transport system, which mediates proper lipoprotein trafficking to the outer membrane, may function suboptimally when improperly acylated. Additionally, altered lipoproteins would interact differently with host pattern recognition receptors, particularly TLR2, potentially modifying immune response dynamics during infection . For H. influenzae researchers, these structural and functional consequences represent both challenges to bacterial viability and potential vulnerabilities that could be exploited for therapeutic intervention .

What genetic approaches can be used to study lnt function in Haemophilus influenzae?

Several sophisticated genetic approaches can be employed to investigate lnt function in Haemophilus influenzae. For gene deletion studies, researchers can utilize unmarked, in-frame deletion techniques similar to those employed for studying other bacterial lipoprotein processing genes. This approach typically involves a two-step allelic exchange process using suicide plasmids containing deletion constructs flanked by homologous regions. For example, research on related bacterial systems has employed "a standard two-step allelic exchange with a sacB suicide plasmid bearing an unmarked, in-frame deletion" . Complementation studies are equally important, requiring stable or unstable plasmids carrying wild-type lnt to restore function in deletion mutants. These can include "unstable hygromycin resistance vectors carrying a copy of the wild-type gene" . For more nuanced functional analysis, site-directed mutagenesis of catalytic residues enables the investigation of specific functional domains without complete gene deletion. Reporter fusion systems using epitope tags (such as HA or cMyc) attached to lipoproteins provide powerful tools for monitoring lnt-dependent processing. These constructs allow researchers to "express a tagged form of the protein" that can be detected by immunoblotting to assess processing differences between wild-type and mutant strains . Finally, conditional expression systems using inducible promoters facilitate the study of essential genes by allowing controlled depletion rather than complete deletion .

What biochemical methods are effective for purifying and characterizing recombinant Haemophilus influenzae lnt?

Purification and characterization of recombinant Haemophilus influenzae lnt requires specialized biochemical approaches due to its nature as a membrane-associated enzyme. For expression systems, E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21) are recommended, with expression vectors containing affinity tags like His6, FLAG, or Strep-tag for purification. Membrane protein solubilization requires careful selection of detergents, with mild non-ionic options like n-dodecyl-β-D-maltoside (DDM) or digitonin often being effective for maintaining enzymatic activity. Purification typically involves immobilized metal affinity chromatography (IMAC) for His-tagged constructs, followed by size exclusion chromatography to achieve high purity. For functional characterization, in vitro acyltransferase assays can be developed using synthetic peptide substrates resembling the N-terminal regions of known H. influenzae lipoproteins, with activity monitored through mass spectrometry to detect acyl transfer. Structural characterization may employ circular dichroism spectroscopy to assess secondary structure content, thermal shift assays to evaluate stability, and potentially X-ray crystallography or cryo-electron microscopy for high-resolution structural determination. Additionally, researchers have successfully implemented affinity purification methods for lipoproteins, which could be adapted to study lnt-substrate interactions: "we affinity purified an abundant lipoprotein, Lpp20 from WT and lnt-deficient strains designed to express a human influenza hemagglutinin (HA)-tagged form of the protein" .

How can mass spectrometry be used to analyze lipoprotein acylation patterns in wild-type versus Δlnt Haemophilus influenzae?

Mass spectrometry offers powerful analytical capabilities for characterizing lipoprotein acylation patterns in wild-type versus Δlnt Haemophilus influenzae strains, providing direct molecular evidence of lnt activity. The experimental workflow begins with careful isolation of lipoproteins, typically using either Triton X-114 phase separation or affinity purification of epitope-tagged lipoproteins. Sample preparation then requires enzymatic or chemical digestion to generate peptide fragments containing the modified N-terminal cysteine residue. For analysis, several complementary mass spectrometry approaches can be employed. Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) provides a rapid assessment of mass differences between wild-type and mutant lipoproteins, with diacylated species from Δlnt mutants showing characteristic mass reductions compared to triacylated counterparts from wild-type bacteria. For detailed structural characterization, liquid chromatography-tandem mass spectrometry (LC-MS/MS) using collision-induced dissociation (CID) or electron transfer dissociation (ETD) fragmentation can precisely determine acylation patterns, including fatty acid composition and linkage positions. Data analysis should focus on the mass shift differences between wild-type and Δlnt samples, which typically correspond to the mass of the missing acyl chain (approximately 230-270 Da depending on the fatty acid). This approach has been validated in other bacterial systems where "such increased mobility has been shown by mass spectrometry to be the result of incomplete acylation" .

What in vivo models are appropriate for studying the role of lnt in Haemophilus influenzae pathogenesis?

Selecting appropriate in vivo models for studying lnt's role in Haemophilus influenzae pathogenesis requires careful consideration of the infection context and specific research questions. For respiratory tract infection models, which are most relevant to H. influenzae's natural niche, several animal systems can be employed. The infant rat model provides an established system for evaluating bacteremia, as demonstrated in studies with H. influenzae proteins where "anti-rPAL antiserum was also protective against type b bacteremia in the infant rat model" . For localized respiratory infections, mouse models of nasopharyngeal colonization or pulmonary infection offer advantages for studying host-pathogen interactions, particularly when combined with transgenic mice lacking specific immune components. Chinchilla models have been valuable for studying otitis media caused by nontypeable H. influenzae strains. To enhance clinical relevance, researchers should consider human respiratory tissue models, including primary human epithelial cell air-liquid interface cultures and ex vivo human lung tissue explants. The latter approach aligns with recent research examining H. influenzae gene expression directly from clinical samples, where investigators found that "bacteria in the patient samples had more diverse transcriptomic signatures and did not group with their lab-cultured counterparts" . When designing in vivo experiments, researchers should compare wild-type, Δlnt mutant, and complemented strains to establish causality. Endpoints should include not only bacterial burden but also inflammatory markers, host tissue damage, and bacterial gene expression profiles .

How might inhibitors of lnt be developed as potential antimicrobials against Haemophilus influenzae?

Development of lnt inhibitors as antimicrobials against Haemophilus influenzae represents a promising therapeutic strategy, particularly given evidence from related bacterial systems suggesting lnt's importance for colonization. The drug discovery pipeline would begin with target validation studies establishing whether lnt is essential for H. influenzae viability or virulence in relevant models. High-throughput screening approaches could then be implemented using either biochemical assays with purified recombinant lnt or cell-based assays monitoring lipoprotein processing. Structure-based drug design approaches may be feasible if crystal structures of H. influenzae lnt or homologous proteins can be obtained. Natural product libraries might yield promising leads, as many existing antibiotics target bacterial lipid metabolism pathways. Lead optimization would require medicinal chemistry efforts to enhance potency, selectivity, and pharmacokinetic properties. Mechanism of action studies would be essential to confirm that candidate compounds specifically inhibit lnt rather than having off-target effects. Research in related pathogens has already identified "lipoprotein synthesis as a target for therapeutic intervention" , suggesting that lnt inhibitors could have broad-spectrum activity against multiple respiratory pathogens. For H. influenzae specifically, lnt inhibitors might be particularly valuable for treating resistant strains or as components of combination therapies targeting different aspects of bacterial physiology .

What is the potential of recombinant lnt-processed lipoproteins as vaccine candidates against Haemophilus influenzae?

Recombinant lnt-processed lipoproteins represent promising vaccine candidates against Haemophilus influenzae, leveraging both their immunogenicity and the precision of recombinant protein technology. Research on H. influenzae outer membrane lipoproteins has already demonstrated their vaccine potential, as exemplified by the Hi-PAL (P6) protein, which "has been shown to elicit bactericidal and protective antibodies against both type b and nontypeable H. influenzae strains and is a vaccine candidate for these organisms" . Importantly, studies have revealed that "the lipid component of Hi-PAL is not required for either immunogenicity or elicitation of biologically active antibodies" , suggesting that recombinant non-lipidated versions of lipoproteins can still induce protective responses. This finding has significant implications for vaccine development, as non-lipidated recombinant proteins are typically easier to produce at scale with consistent quality. For researchers designing lnt-related vaccines, several approaches could be pursued: (1) focusing on highly conserved lipoproteins processed by lnt to provide cross-strain protection, (2) creating recombinant fusion proteins containing multiple protective epitopes, similar to how "a genetic fusion was constructed that contains the sequence of mature Hi-PAL fused to the polylinker region of pUC19" , and (3) exploring adjuvant combinations that can compensate for any reduction in intrinsic immunostimulatory properties when the native lipid modifications are absent .

How can structural biology approaches advance our understanding of Haemophilus influenzae lnt for drug discovery?

Structural biology approaches offer transformative potential for understanding Haemophilus influenzae lnt at the molecular level, directly accelerating structure-based drug discovery efforts. X-ray crystallography remains the gold standard for high-resolution structural determination, though crystallizing membrane proteins like lnt presents significant challenges requiring specialized approaches such as lipidic cubic phase crystallization or co-crystallization with antibody fragments to enhance stability. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly for membrane proteins, potentially allowing visualization of lnt in different conformational states during catalysis. Nuclear magnetic resonance (NMR) spectroscopy, while challenging for full-length lnt, could provide valuable insights into ligand binding and protein dynamics through focused studies on critical domains. Complementary computational approaches include homology modeling based on structurally characterized lnt proteins from related bacteria, molecular dynamics simulations to understand conformational flexibility, and in silico docking studies to identify potential inhibitor binding sites. These structural insights would enable rational drug design strategies, including fragment-based approaches to develop small molecules that disrupt essential catalytic functions. The combination of structural information with functional studies would allow researchers to precisely target critical regions of lnt, potentially yielding highly specific inhibitors with reduced off-target effects. As seen with other bacterial enzymes, structural biology has the potential to identify unexpected druggable pockets and allosteric sites that might not be apparent from sequence analysis alone .

What are the implications of lnt research for understanding and treating nontypeable Haemophilus influenzae infections?

Research on lnt has significant implications for addressing the growing clinical challenge of nontypeable Haemophilus influenzae (NTHi) infections, which have become increasingly prevalent since the implementation of type b conjugate vaccines. NTHi strains are genetically diverse and lack capsular antigens, making vaccine development challenging and increasing the importance of identifying conserved virulence factors like lnt. Lipoproteins processed by lnt play critical roles in NTHi pathogenesis, including adhesion, nutrient acquisition, and stress resistance. Research has demonstrated that certain H. influenzae lipoproteins, such as Hi-PAL (P6), "elicit bactericidal and protective antibodies against both type b and nontypeable H. influenzae strains" , highlighting their potential as therapeutic targets. By understanding lnt-dependent lipoprotein processing in NTHi, researchers can identify vulnerabilities in the bacterial lifecycle that could be exploited therapeutically. This is particularly relevant given that NTHi infections often involve biofilm formation and intracellular persistence, where specialized lipoproteins may be essential. Furthermore, recent transcriptomic analysis of H. influenzae during human lung infection revealed significant differences between in vitro and in vivo gene expression , emphasizing the importance of studying lnt function under physiologically relevant conditions. As antibiotic resistance continues to emerge in NTHi, targeting non-conventional pathways like lipoprotein processing could provide alternative treatment strategies, potentially "identifying lipoprotein synthesis as a target for therapeutic intervention" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.