Recombinant Haemophilus influenzae Arginine ABC transporter permease protein ArtM (artM)

Shipped with Ice Packs
In Stock

Description

Critical Residues and Functional Insights

ArtM’s second extracellular loop contains residues essential for interaction with ArtI. Mutagenesis studies identified:

  • K177, R185, E188: Charged residues critical for salt bridge formation with ArtI. Mutations to oppositely charged residues (e.g., K177D, R185E) abolished ArtJ-stimulated ATPase activity in proteoliposomes .

ResidueRolePhenotype of MutationSource
K177Salt bridge formation with ArtILoss of ATPase activity
R185Electrostatic interaction with ArtI’s E163Complete loss of transport function
E188Potential secondary interaction siteReduced binding affinity for ArtI

Recombinant Variants and Applications

Multiple recombinant ArtM variants are available for research:

VariantHost SystemPuritySource
Full-length His-taggedE. coli≥85%
Partial/TruncatedE. coli or Cell-free≥85%
Partial ArtM (1-227 aa)E. coli≥85%

These variants are used in structural studies, protein-protein interaction assays, and functional reconstitution in proteoliposomes .

Interaction Network and Functional Partners

ArtM interacts with components of the ArtPIQM system and other ABC transporters:

PartnerRoleInteraction ScoreSource
ArtIPeriplasmic-binding protein for arginine0.998
ArtPATP-binding subunit for energy coupling0.997
ArtQHomologous permease subunit forming heterodimer with ArtM0.993
HI_1080Periplasmic-binding protein for amino acids (uncharacterized)0.897

Research Implications

  • Transport Mechanism: ArtM’s role in the “elevator-with-an-operator” model suggests a conformational change driven by ATP hydrolysis and substrate binding .

  • Disease Relevance: H. influenzae relies on arginine uptake for survival, making ArtM a potential target for antimicrobial strategies .

  • Structural Studies: High-resolution crystallography of ArtQM homologs (e.g., SiaQM) informs mechanistic hypotheses for ArtM .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
artM; HI_1177; Arginine ABC transporter permease protein ArtM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
artM
Target Protein Sequence
MFQEYLSVIVKGIPTSLLLTVVSLLIAFFLALFLTFLLSMENKWIKSAVNLYLTLFTGTP LLVQFFLIYAGPGQFQWIIDSPLWYVLSNAWFCAALALALNSAAYSTQLFHGAVKAIPKG QWESCGALGLNRIQTLKILIPYALKRALPSYSNEIILVFKGTALASTITIMDIMGYARQL YGTEYDALTIYGIAGGIYLIITGIATLLLRKLEKKVLAFERFEVSKA
Uniprot No.

Target Background

Function
Part of the ABC transporter complex ArtPIQM involved in arginine transport. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: hin:HI1177

STRING: 71421.HI1177

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the ArtM protein function within the complete ABC transporter system?

The ArtM protein functions as an integral membrane component of the Arginine ABC transporter system. In a complete ABC transporter system, three main components work together:

  • A substrate-binding protein (often periplasmic in Gram-negative bacteria)

  • Permease proteins (membrane-spanning components like ArtM)

  • ATP-binding protein (provides energy through ATP hydrolysis)

ArtM specifically forms the transmembrane channel through which arginine passes. It works in conjunction with other proteins in the system, including ArtQ (another permease protein) and ArtP (the ATP-binding protein) . The transport process begins when the substrate-binding protein captures arginine in the periplasm. The substrate-binding protein then interacts with the permease components (ArtM/ArtQ), triggering a conformational change that allows arginine to pass through the membrane channel. This process is energized by the ATP-binding protein (ArtP), which hydrolyzes ATP to provide the energy necessary for transport .

Similar to other characterized ABC transporters, the Haemophilus influenzae arginine transport system likely functions with Michaelis-Menten kinetics, with an apparent Km in the micromolar range, as observed in the functionally related hFbpABC iron transporter (Km of 0.9 μM) .

What are the optimal expression systems for producing recombinant ArtM protein?

Recombinant Haemophilus influenzae ArtM protein can be expressed using several expression systems, with E. coli being the most commonly used host. Based on available data, the following expression systems have been successfully employed:

Expression SystemTagAdvantagesConsiderations
E. coliHisHigh yield, cost-effective, well-established protocolsPotential issues with membrane protein folding
Cell-free expressionHisEliminates cellular toxicity issues, rapid productionHigher cost, potentially lower yield
Mammalian cellsHisBetter for complex folding/post-translational modificationsHigher cost, longer production time
YeastHisGood for eukaryotic proteins, high yieldLonger production time
BaculovirusHisExcellent for complex proteinsMore complex protocol

For optimal expression of ArtM, an N-terminal His-tag fusion approach has been documented to facilitate purification while maintaining protein function . E. coli has proven to be an effective host for expression of the full-length protein (1-227 amino acids) . The protein is typically expressed as a His-tagged fusion protein to facilitate purification using affinity chromatography.

For researchers requiring high purity samples, it's recommended to aim for purity greater than 85-90% as determined by SDS-PAGE analysis .

What are the critical steps in purifying functional ArtM protein?

Purification of functional ArtM protein involves several critical steps:

  • Membrane Extraction: As ArtM is a membrane protein, effective extraction from the cell membrane is crucial. Typically, this involves cell lysis followed by membrane fraction isolation.

  • Detergent Solubilization: The membrane fraction containing ArtM must be solubilized using appropriate detergents. Common detergents include n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG).

  • Affinity Purification: His-tagged ArtM can be purified using immobilized metal affinity chromatography (IMAC). Ni-NTA or Co-NTA resins are commonly used.

  • Buffer Optimization: The buffer composition is critical for maintaining protein stability and functionality. Typically, a Tris/PBS-based buffer with pH 8.0 is recommended for storage .

  • Reconstitution or Stabilization: For functional studies, the purified ArtM may need to be reconstituted into lipid bilayers or stabilized using amphipols or nanodiscs, similar to approaches used for other membrane transporters like SiaQM from H. influenzae .

After purification, the protein should be stored with 5-50% glycerol, with 50% being the recommended final concentration to prevent freeze-thaw damage. Aliquoting for long-term storage at -20°C/-80°C is advisable to avoid repeated freeze-thaw cycles .

How can researchers design experiments to characterize ArtM substrate specificity and transport kinetics?

To characterize ArtM substrate specificity and transport kinetics, researchers should consider the following experimental approaches:

  • Radiolabeled Substrate Transport Assays: Similar to studies on the hFbpABC transporter , researchers can use radiolabeled arginine to measure transport rates. This approach allows determination of Michaelis-Menten kinetic parameters (Km and Vmax).

  • Complementation Experiments: To confirm the role of ArtM in arginine transport, complementation studies in transport-deficient strains can be performed. This involves expressing ArtM (alone or with other components) and measuring the restoration of transport function .

  • Competition Assays: To determine substrate specificity, transport of labeled arginine can be measured in the presence of potential competing substrates. This approach can reveal whether the transporter has specificity for arginine alone or can transport other amino acids.

  • Inhibitor Studies: ATPase inhibitors like sodium orthovanadate can be used to confirm the ATP-dependence of transport. Similarly, protonmotive force inhibitors like carbonyl cyanide m-chlorophenylhydrazone (CCCP) can determine if the transport is also dependent on proton gradients .

  • Transport Reconstitution: For definitive characterization, the purified ArtM protein (along with its partner proteins) can be reconstituted into liposomes, and transport measured in this controlled system.

For kinetic analyses, researchers should use the Michaelis-Menten equation to derive the apparent Km and Vmax values from their experimental data. Based on similar ABC transporters in H. influenzae, expected Km values would be in the micromolar range (approximately 0.9 μM) .

What methods are available for studying ArtM interactions with other components of the ABC transporter complex?

Several techniques can be employed to study interactions between ArtM and other components of the Arginine ABC transporter complex:

  • Co-immunoprecipitation (Co-IP): Using antibodies against ArtM or its partner proteins (ArtQ, ArtP), researchers can pull down protein complexes and identify interacting partners through western blotting or mass spectrometry.

  • Surface Plasmon Resonance (SPR): This technique allows real-time monitoring of protein-protein interactions and can determine binding affinities. For example, the affinity (KD) between the soluble SiaP protein and SiaQM (another ABC transporter in H. influenzae) was found to be in the micromolar range using similar biophysical techniques .

  • Förster Resonance Energy Transfer (FRET): By tagging ArtM and potential interacting partners with fluorescent proteins, FRET can detect close proximity indicative of protein-protein interactions.

  • Bacterial Two-Hybrid System: This genetic method can screen for interactions between ArtM and other proteins in vivo.

  • Cryo-Electron Microscopy (cryo-EM): This structural technique can reveal the architecture of the entire transporter complex at near-atomic resolution, as demonstrated with the SiaQM transporter from H. influenzae (resolved at 2.99 Å, with local resolution extending to ~2.2 Å) .

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can identify interaction sites between ArtM and other components of the transporter.

These approaches can provide complementary information about the assembly, stoichiometry, and dynamics of the ArtM-containing ABC transporter complex.

How does the structure of ArtM relate to its function in arginine transport?

The structure-function relationship of ArtM can be inferred from studies on similar ABC transporters, including the recently characterized SiaQM transporter from H. influenzae :

  • Transmembrane Domains: ArtM contains multiple transmembrane helices that form the channel through which arginine passes. These helices likely undergo conformational changes during the transport cycle, similar to the "elevator-with-an-operator" mechanism proposed for TRAP transporters .

  • Substrate-Binding Site: Within the transmembrane domains, specific residues form the substrate-binding site. By analogy with other transporters, this site likely contains charged and polar residues that interact with the guanidinium group and α-carboxyl and α-amino groups of arginine.

  • Interaction Interfaces: ArtM must interact with other components of the transporter, including ArtQ (another permease protein) and ArtP (the ATP-binding protein). These interaction surfaces are critical for coordinating the conformational changes required for transport.

  • Homodimerization: Similar to SiaQM, ArtM may form homodimers, with lipids potentially mediating the dimer interface . This dimerization could be important for transporter function or stability.

  • Coupling Mechanism: The structure of ArtM must allow for coupling between ATP hydrolysis (occurring at the ATP-binding protein) and the conformational changes in the permease that drive substrate translocation.

Mutagenesis studies targeting conserved residues in ArtM would help elucidate which amino acids are critical for substrate recognition, channel formation, and protein-protein interactions within the transport complex.

What are the key structural differences between ArtM and other ABC transporter permease proteins?

Comparative analysis of ArtM with other ABC transporter permease proteins reveals several key differences:

  • Substrate Specificity Determinants: ArtM is specialized for arginine transport, whereas other permeases like SiaQM are adapted for different substrates such as N-acetylneuraminate . This specialization is reflected in the amino acid composition of the substrate-binding pocket.

  • Domain Organization: While ArtM functions as a permease component, some ABC transporters in H. influenzae have evolved fused domains. For example, SiaQM represents a fusion of the Q and M subunits , while ArtM remains as a separate protein working in conjunction with ArtQ.

  • Evolutionary Conservation: Analysis of ArtM sequences across different strains of H. influenzae and related bacteria can reveal conserved regions that are likely critical for function, as well as variable regions that may confer species-specific properties.

  • Membrane Topology: The arrangement of transmembrane helices may differ between ArtM and other permease proteins, reflecting adaptations for different substrates and transport mechanisms.

  • Regulatory Elements: ArtM may possess unique structural elements that allow for regulation by cellular factors, similar to how the arginine permease system in yeast is regulated by nitrogen availability .

Understanding these structural differences is crucial for developing targeted approaches to modulate ArtM function, which could have implications for understanding H. influenzae pathogenesis and developing novel antimicrobial strategies.

How does the ArtM-mediated arginine transport contribute to Haemophilus influenzae pathogenesis?

The ArtM-mediated arginine transport system plays several important roles in H. influenzae physiology and potentially in pathogenesis:

  • Nutritional Acquisition: Arginine is an essential amino acid for H. influenzae, which lacks the complete biosynthetic pathway for its production. Efficient arginine uptake through the Art transport system is therefore critical for bacterial growth and survival in host environments .

  • Stress Response: Arginine can serve as a precursor for polyamine synthesis, which helps bacteria cope with oxidative stress encountered during infection. The Art transport system may therefore contribute to stress resistance.

  • pH Homeostasis: Arginine can be metabolized through the arginine deiminase pathway, which generates ammonia and helps neutralize acidic environments. This may aid H. influenzae survival in certain host niches.

  • Protein Synthesis: As an amino acid, arginine is required for protein synthesis. Efficient arginine transport ensures adequate supplies for the synthesis of virulence factors and other essential proteins.

  • Biofilm Formation: Some studies with related bacteria suggest that arginine metabolism affects biofilm formation, which is an important virulence mechanism for H. influenzae, particularly in chronic infections.

Similar to other ABC transporters identified in H. influenzae, such as the hFbpABC system for iron acquisition , the ArtM-containing transporter likely contributes to bacterial fitness during infection. The ArtM system may be particularly important during colonization of the respiratory tract, where H. influenzae must compete with other microorganisms for limited nutrients .

How can researchers assess the contribution of ArtM to bacterial survival in different host environments?

To assess the contribution of ArtM to bacterial survival in different host environments, researchers can employ several experimental approaches:

  • Generation of Isogenic Mutants: Similar to approaches used for studying other transport systems in H. influenzae, researchers can create isogenic artM mutants using techniques like the transformed recombinant enrichment profiling (TREP) methodology . These mutants can then be compared to wild-type strains in various assays.

  • In Vitro Growth Studies: Comparing growth of wild-type and artM mutant strains in media with different arginine concentrations or under various stress conditions can reveal the importance of ArtM for bacterial growth and stress resistance.

  • Cell Culture Infection Models: Human airway epithelial cell infection models can be used to assess the role of ArtM in adherence, invasion, and intracellular survival, similar to studies that identified HMW1 as an intracellular invasion factor .

  • Animal Infection Models: Mouse models of respiratory infection or otitis media can be used to compare the virulence and persistence of wild-type and artM mutant strains in vivo.

  • Complementation Studies: Reintroducing the wild-type artM gene into mutant strains should restore the wild-type phenotype if the observed defects are specifically due to loss of ArtM function.

  • Competition Assays: Co-infection with wild-type and artM mutant strains can reveal subtle fitness advantages conferred by ArtM in specific host environments.

  • Transcriptomic Analysis: RNA sequencing can identify genes that are differentially expressed in response to artM mutation, providing insights into the broader physiological impact of arginine transport disruption.

These approaches collectively can provide a comprehensive understanding of how ArtM-mediated arginine transport contributes to H. influenzae survival and virulence in different host niches.

How can ArtM be utilized as a target for antimicrobial development?

ArtM represents a potential target for antimicrobial development for several reasons:

  • Essential Function: If arginine transport is essential for H. influenzae survival in the host, inhibitors of ArtM could have bacteriostatic or bactericidal effects.

  • Specificity: The differences between bacterial and human amino acid transporters could allow for the development of selective inhibitors that target bacterial ArtM without affecting human transporters.

  • Accessibility: As a membrane protein exposed to the periplasmic space, ArtM may be more accessible to inhibitors than cytoplasmic targets.

Approaches for targeting ArtM include:

  • Structure-Based Drug Design: Using structural information (potentially inferred from related transporters like SiaQM ) to design small molecules that bind to and inhibit ArtM function.

  • Peptidomimetics: Developing peptides that mimic arginine but cannot be transported, thereby competitively inhibiting the natural substrate.

  • Antibody-Based Approaches: Generating antibodies against exposed regions of ArtM that could interfere with its function.

  • Allosteric Inhibitors: Identifying compounds that bind to sites distinct from the substrate-binding site but induce conformational changes that prevent transport.

  • Combination Approaches: Using ArtM inhibitors in combination with conventional antibiotics to enhance efficacy or overcome resistance.

The development process would involve initial screening of compound libraries, followed by optimization of lead compounds and testing in cell culture and animal models of H. influenzae infection.

What are the challenges in designing ArtM inhibitors, and how might they be overcome?

Designing effective inhibitors of ArtM presents several challenges:

  • Membrane Protein Target: As a membrane protein, ArtM presents difficulties for structural studies and inhibitor design. This challenge might be addressed by:

    • Using cryo-EM approaches similar to those that successfully resolved the structure of SiaQM

    • Employing computational modeling based on homologous proteins

    • Developing fragment-based approaches that don't require complete structural information

  • Specificity vs. Broad-Spectrum Activity: Inhibitors may need to target ArtM specifically in H. influenzae or work broadly against homologous transporters in other pathogens. Researchers can:

    • Perform comparative analyses of ArtM sequences across multiple pathogens

    • Target conserved regions for broad-spectrum activity

    • Focus on species-specific regions for narrow-spectrum agents

  • Penetration Barriers: Inhibitors must cross the outer membrane of H. influenzae to reach ArtM in the inner membrane. Strategies include:

    • Designing compounds that can utilize porin channels for entry

    • Creating prodrugs that are modified after entry

    • Developing conjugates with siderophores or other transport systems

  • Resistance Development: Bacteria may develop resistance through mutations in ArtM or by upregulating alternative transport systems. Researchers can:

    • Target highly conserved residues where mutations would likely impair function

    • Develop combination strategies targeting multiple transport systems

    • Monitor resistance development in laboratory evolution experiments

  • Validation in Complex Models: Demonstrating efficacy in relevant infection models is challenging. Approaches include:

    • Developing improved animal models that better mimic human infections

    • Using human tissue models or organoids

    • Combining in vitro and in vivo approaches to build a comprehensive efficacy profile

By addressing these challenges systematically, researchers can increase the likelihood of developing effective ArtM inhibitors as potential therapeutics against H. influenzae infections.

How can advanced imaging techniques enhance our understanding of ArtM structure and function?

Advanced imaging techniques offer powerful tools for elucidating ArtM structure and function:

  • Cryo-Electron Microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology, as demonstrated by the recent 2.99 Å resolution structure of the SiaQM transporter from H. influenzae . For ArtM, cryo-EM could:

    • Reveal the complete 3D structure at near-atomic resolution

    • Capture different conformational states during the transport cycle

    • Visualize interactions with other components of the transporter

  • Single-Particle Tracking: Using fluorescently labeled ArtM proteins, researchers can track individual transporters in living bacterial cells to understand:

    • Dynamic distribution in the bacterial membrane

    • Clustering behavior with other transporter components

    • Changes in mobility in response to substrate availability

  • Super-Resolution Microscopy: Techniques like STORM, PALM, or STED microscopy can overcome the diffraction limit to provide detailed views of:

    • ArtM distribution patterns in the membrane

    • Co-localization with other components of the transport system

    • Changes in organization during different growth phases

  • Correlative Light and Electron Microscopy (CLEM): This approach combines the specificity of fluorescence microscopy with the high resolution of electron microscopy to:

    • Precisely localize ArtM within the cellular ultrastructure

    • Connect functional studies with structural information

  • Atomic Force Microscopy (AFM): AFM can provide topographical information about ArtM in lipid bilayers and measure:

    • Conformational changes during transport

    • Forces involved in substrate binding and transport

    • Interactions with other membrane components

These advanced imaging approaches, especially when combined with complementary biochemical and genetic studies, promise to provide unprecedented insights into the structure, dynamics, and function of ArtM in the context of the complete arginine transport system.

What are the emerging genetic tools for studying ArtM function in Haemophilus influenzae?

Several emerging genetic tools are enhancing researchers' ability to study ArtM function in H. influenzae:

  • CRISPR-Cas9 Gene Editing: This technology enables precise genetic manipulation of H. influenzae, allowing:

    • Clean deletion of artM with minimal polar effects

    • Introduction of point mutations to study structure-function relationships

    • Fluorescent tagging of ArtM for localization studies

  • Transformed Recombinant Enrichment Profiling (TREP): This methodology, already applied to identify invasion factors in H. influenzae , could be used to:

    • Identify genetic backgrounds where ArtM function is essential

    • Discover genes that interact genetically with artM

    • Map domains critical for ArtM function through random mutagenesis

  • Inducible Expression Systems: Tightly controlled gene expression systems allow:

    • Conditional depletion of ArtM to study acute effects

    • Overexpression studies to identify dosage-dependent phenotypes

    • Pulse-chase experiments to study ArtM turnover and stability

  • Riboswitch-Based Reporters: Synthetic biology approaches can create:

    • Arginine-responsive reporters to monitor transport efficiency

    • High-throughput screens for ArtM inhibitors

    • In vivo sensors of ArtM activity

  • Transposon Sequencing (Tn-Seq): This approach can identify:

    • Genes that become essential in artM mutants (synthetic lethality)

    • Mutations that suppress artM mutant phenotypes

    • Growth conditions where ArtM is particularly important

These emerging tools, combined with traditional genetic approaches, provide a powerful toolkit for dissecting ArtM function in H. influenzae and understanding its role in bacterial physiology and pathogenesis.

What are common challenges in the production and analysis of recombinant ArtM, and how can they be addressed?

Researchers working with recombinant ArtM often encounter several challenges:

  • Low Expression Levels: Membrane proteins like ArtM typically express at lower levels than soluble proteins.

    • Solution: Optimize expression conditions by screening different promoters, host strains, and induction parameters. Consider cell-free expression systems that have been successful for ArtM production .

  • Protein Misfolding and Aggregation: Membrane proteins are prone to misfolding when overexpressed.

    • Solution: Express at lower temperatures (16-20°C) and use specialized E. coli strains (C41, C43) designed for membrane protein expression. Consider fusion partners that enhance folding.

  • Inefficient Solubilization: Extracting ArtM from membranes while maintaining its native structure is challenging.

    • Solution: Screen different detergents systematically. Start with mild detergents like DDM or LMNG. Consider alternative solubilization strategies like styrene maleic acid lipid particles (SMALPs).

  • Protein Instability: Purified ArtM may be unstable in solution.

    • Solution: Optimize buffer conditions (pH, salt, additives). Include stabilizing agents like glycerol (5-50%) . Consider reconstitution into nanodiscs or liposomes for long-term stability.

  • Functional Assessment: Verifying that recombinant ArtM retains transport activity is difficult.

    • Solution: Develop reconstituted transport assays in liposomes. Use complementation of transport-deficient bacterial strains as a functional readout. Consider indirect measures of function such as substrate binding assays.

  • Protein-Protein Interactions: ArtM functions as part of a complex with other proteins.

    • Solution: Co-express ArtM with ArtQ and ArtP partners. Alternatively, purify components separately and reconstitute the complex in vitro under controlled conditions.

  • Structural Studies: Obtaining structural information for membrane proteins is challenging.

    • Solution: Consider cryo-EM approaches that have been successful for similar transporters . Use molecular modeling based on homologous proteins if experimental structures are unavailable.

By anticipating these challenges and implementing appropriate solutions, researchers can enhance their success in working with recombinant ArtM.

How can researchers optimize experimental design for studying ArtM in different genetic backgrounds?

Optimizing experimental design for studying ArtM across different genetic backgrounds requires careful consideration of several factors:

  • Strain Selection: Different H. influenzae strains may exhibit varying dependency on arginine transport.

    • Approach: Include multiple reference strains (e.g., laboratory strain Rd KW20 and clinical isolates like 86-028NP ) to capture strain-specific variations in ArtM function.

    • Control: Always include well-characterized strains as controls to facilitate cross-study comparisons.

  • Mutant Construction: Creating clean artM mutations without polar effects is essential.

    • Approach: Use markerless deletion techniques or CRISPR-Cas9 editing to minimize disruption of neighboring genes.

    • Validation: Confirm mutations by sequencing and test for potential polar effects on adjacent genes using RT-PCR.

  • Complementation Strategy: Proper complementation controls are critical.

    • Approach: Use both cis and trans complementation approaches. Ensure expression levels in complemented strains approximate wild-type levels.

    • Controls: Include both empty vector controls and complementation with mutated versions of artM as specificity controls.

  • Growth Conditions: ArtM importance may vary with growth conditions.

    • Approach: Test multiple media compositions, particularly varying arginine availability. Include both rich and minimal media conditions.

    • Measurements: Monitor growth curves over time rather than single endpoint measurements to capture subtle phenotypes.

  • Statistical Design: Robust statistical approaches enhance reproducibility.

    • Approach: Use factorial experimental designs with appropriate randomization and blinding procedures.

    • Analysis: Consider using aligned rank transform (ART) ANOVA for analyzing non-parametric data from factorial designs .

  • Phenotypic Assays: Select assays relevant to ArtM function.

    • Approach: Include measurements of arginine uptake, growth rates in arginine-limited conditions, and stress responses.

    • Context: Test phenotypes in conditions relevant to host environments, such as reduced pH, serum exposure, or biofilm formation.

  • Transcriptional Analysis: Changes in gene expression can provide insights into ArtM function.

    • Approach: Use RNA-seq or targeted RT-qPCR to measure expression of artM and related genes under different conditions.

    • Integration: Correlate expression data with phenotypic outcomes to build a more complete picture of ArtM function.

By implementing these optimized experimental approaches, researchers can generate more robust and reproducible data on ArtM function across different genetic backgrounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.