Recombinant Haemophilus influenzae ATP-binding/permease protein CydD (cydD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Haemophilus influenzae ATP-Binding/Permease Protein CydD (cydD)

Recombinant Haemophilus influenzae ATP-binding/permease protein CydD (cydD) is a transmembrane protein involved in bacterial ATP-binding cassette (ABC) transporter systems. It plays critical roles in nutrient uptake, stress response, and pathogenicity . This protein is expressed recombinantly for biochemical and functional studies, enabling researchers to explore its structural and mechanistic properties .

Molecular Characterization

Gene and Protein Details

  • Gene Name: cydD

  • UniProt ID: P45082

  • Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Protein Length: 588 amino acids

Sequence Features
The full-length protein includes conserved domains typical of ABC transporters:

  • ATP-binding motifs: Walker A and Walker B sequences critical for ATP hydrolysis .

  • Transmembrane helices: Predicted to form channels for substrate translocation .

PropertyDetails
Amino Acid SequenceMNKLRQKYLQKWLRAQQEPIKKLMRANIVLATLSSFILVAQTYFLATLLDKLIMQNVPRD... (truncated)
Molecular Weight~67 kDa (calculated)
Post-Translational FeaturesNo known glycosylation sites; lipid-binding domains inferred from homologs .

Recombinant Expression and Purification

Expression System

  • Host: Escherichia coli

  • Tag: N-terminal His-tag for affinity chromatography .

Functional Studies

  • Glutathione Import: H. influenzae CydD is essential for importing oxidized glutathione (GSSG), a critical pathway for cysteine acquisition and redox homeostasis .

  • Heme Utilization: While not directly binding heme, CydD homologs in other bacteria interact with heme-binding proteins, suggesting indirect roles in iron metabolism .

Pathogenicity Links

  • ABC transporters like CydD contribute to H. influenzae virulence by scavenging nutrients during infection .

  • Knockout mutants of cydD show reduced survival under oxidative stress, highlighting its role in host adaptation .

Comparative Analysis with Homologs

FeatureH. influenzae CydDE. coli CydD
Gene IDHI_RS03470 b0887
Protein Length588 aa588 aa
Substrate SpecificityGSSG, cysteine derivatives Cytochrome oxidase assembly
Structural MotifsWalker A/B, transmembrane helicesSimilar ATP-binding domains

Future Directions

  • Structural Resolution: High-resolution cryo-EM or crystallography studies are needed to elucidate substrate-binding pockets.

  • Therapeutic Targeting: Inhibitors of CydD could disrupt bacterial nutrient uptake, offering novel antibiotic strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cydD; HI_1157; ATP-binding/permease protein CydD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
cydD
Target Protein Sequence
MNKLRQKYLQKWLRAQQEPIKKLMRANIVLATLSSFILVAQTYFLATLLDKLIMQNVPRD ELIPYFLGLIIGFGMRAIILWAREKIGFQSGQLLRNHIRQKILDKIHLVGPATINQKPAG SWASIMLEQVENLHNFYARFLPQQSLSAIVPVVIFIAVFPLNWAAGLILMITAPLVPLFM IIVGIAAADNSQKNMDTLSRLSAQFLDRLRGLETLRLFNRTSEQTEHIENATEDFRETTM DVLKLAFLSSAVLEFFTSISIALMAVYFGFSYLGQIEFGTYNAPLTLFTGFFCLILAPEF YQPLRDLGTYYHDRAAGIGAADAIVDFLESDYLTVHQNEKTISLESAVEISAENLVVLST QGSALTKPLNFQIPANHNVALVGQSGAGKTSLMNVILGFLPYEGSLKINGQELRESNLAD WRKHIAWVGQNPLLLQGTIKENLLLGDVQANDEEINQALMRSQAKEFTDKLGLHHEIKDG GLGISVGQAQRLAIARALLRKGDLLLLDEPTASLDAQSENLVLQALNEASQHQTTLMITH RIEDLKQCDQIFVMQRGEIVQQGKFTELQHEGFFAELLAQRQQDIQ
Uniprot No.

Target Background

Function
CydD is involved in the cytochrome D branch of aerobic respiration. It appears to be a component of a transport system.
Database Links

KEGG: hin:HI1157

STRING: 71421.HI1157

Protein Families
ABC transporter superfamily, Cysteine exporter (TC 3.A.1.129.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of CydD in Haemophilus influenzae?

CydD functions as an essential component of the ATP-binding cassette (ABC) transporter system in H. influenzae, specifically as part of the CydDC complex. This complex plays a crucial role in the transport of substrates across the bacterial membrane, particularly in the import of glutathione (GSH) and oxidized glutathione (GSSG). In H. influenzae Rd, which is a glutathione auxotroph, this transport system is vital for acquiring cysteine from the environment through glutathione uptake . The gene encoding CydD in H. influenzae Rd was identified as ORF HI1187, which encodes a permease-like protein homologous to E. coli components . Functional analysis through transposon mutagenesis demonstrated that disruption of this gene results in the inability of H. influenzae to utilize GSSG as a cysteine source, highlighting its essential role in nutrient acquisition .

How does CydD interact with other components of the ABC transporter complex?

CydD operates as part of the CydDC complex, where it interacts with several other proteins to form a functional transporter unit. Within this complex, CydD collaborates with the dppBCDF operon components that collectively form the GSSG importer in H. influenzae Rd . The functional assembly requires both the permease components (including CydD) and the nucleotide-binding domains (NBDs) that power the transport process through ATP hydrolysis .

The interaction between these components involves conformational changes coordinated between the transmembrane domains and the NBDs. During the transport cycle, ATP binding and hydrolysis at the NBDs trigger conformation changes that propagate to the transmembrane domains, creating alternating access for substrate binding and release . Specifically, CydD's transmembrane helix 4 exhibits significant conformational plasticity that controls the membrane-accessible substrate entry site . This structural flexibility enables CydD to coordinate with CydC's nucleotide-binding domain through coupling with its extended cytoplasmic segment .

What experimental systems are available for studying CydD function?

Several experimental systems have been developed to study CydD function in H. influenzae, providing researchers with methodological approaches for functional characterization:

Experimental SystemApplicationKey Advantages
Chemically defined minimal medium (cdMIc)Growth-dependent functional assaysAllows screening for mutants unable to utilize specific substrates (e.g., GSSG vs. cystine)
Transposon mutagenesisGene identification and functional validationEnables systematic screening of large mutant libraries
Homology-based insertion/disruption mutagenesisTargeted gene disruptionAllows precise manipulation of specific genes with minimal polar effects
Complementation assaysFunctional validationConfirms gene function through restoration of phenotype
Recombinant protein expressionBiochemical and structural studiesEnables purification for in vitro characterization

To implement these systems, researchers typically use H. influenzae Rd as a model system. This strain is a nonencapsulated, nonpathogenic derivative of a serotype d strain with a genome approximately 270 kb smaller than virulent type b strains . This makes it amenable to genetic manipulation while maintaining the essential characteristics of the CydD transport system .

What are the structural dynamics of CydD during the substrate transport cycle?

The structural dynamics of CydD during substrate transport involve complex conformational changes that facilitate the alternating access mechanism characteristic of ABC transporters. High-resolution structural studies using cryo-electron microscopy (cryo-EM) have revealed that CydD undergoes significant conformational transitions between inward-facing, occluded, and outward-facing states during the transport cycle .

The most striking feature of CydD's structural dynamics is the remarkable conformational plasticity of transmembrane helix 4 (TM4). During substrate binding, CydD adopts a highly asymmetrical inward-facing conformation that enables lateral entry of substrates from the membrane space . This asymmetry is critical for creating the necessary access pathway for bulky substrates like heme, which binds laterally to the transmembrane region .

Following substrate binding, the extended cytoplasmic segment of CydD's TM4 couples substrate confinement to a rotational movement of the CydC nucleotide-binding domain . This signal transduction mechanism is essential for driving conformational transitions toward occluded and outward-open states that complete the transport cycle . These structural rearrangements ensure unidirectional transport and prevent substrate backflow during the process.

The conformational landscape of CydD has been mapped using systematic single-particle cryo-EM approaches combined with atomistic molecular dynamics simulations, revealing up to 39 individual structures under 22 different sample conditions at resolutions ranging from 2.7 to 3.9 Å . This comprehensive structural characterization provides a detailed atomic-level understanding of CydD's dynamic behavior during transport.

How do ATP binding and hydrolysis coordinate with substrate transport in CydD?

The coordination between ATP binding/hydrolysis and substrate transport in CydD follows a sophisticated mechanism that ensures energetic efficiency. Research indicates that the nucleotide-binding domains (NBDs) of the CydDC complex operate through an alternating catalysis model where ATP hydrolysis events are coordinated with specific stages of the transport cycle .

  • ATP hydrolysis can occur at only one site at a time, with the sites alternating in catalysis

  • One ATP molecule is hydrolyzed for each substrate molecule transported

  • The transporter "remembers" which site hydrolyzed ATP last, creating an alternating mechanism

This model is supported by experiments using transition state analogs like Mg·ADP·Vi (vanadate), which trap the complex in a post-hydrolysis conformation at just one site . This observation suggests that hydrolysis occurs at only one site at a time, with alternating catalysis between the two sites .

The coupling between ATP hydrolysis and substrate translocation is mediated by conformational changes that propagate from the NBDs to the transmembrane domains. For CydD specifically, the extended cytoplasmic segment of transmembrane helix 4 plays a crucial role in coupling substrate confinement to NBD rotation, driving the conformational transitions necessary for transport .

What experimental approaches are most effective for studying CydD substrate specificity?

Investigating CydD substrate specificity requires a multi-faceted experimental approach that combines genetic, biochemical, and structural methods. Based on current research, the following methodological framework proves most effective:

ApproachMethodologyData OutputAdvantages
Genetic ScreeningGrowth complementation assays using cdMIc medium with different potential substratesBinary growth/no-growth phenotypesIdentifies physiologically relevant substrates in vivo
Competitive InhibitionTesting substrate transport in the presence of structural analogsInhibition profiles with IC50 valuesDefines binding site characteristics and structural requirements
Direct Binding AssaysUsing purified recombinant HbpA/CydD proteins with potential substratesBinding constants and thermodynamic parametersQuantifies direct interactions independent of transport
Molecular DynamicsAtomistic simulations of CydD with various substratesBinding energies and conformational changesProvides atomic-level insights into recognition mechanisms
Mutational AnalysisSystematic mutation of potential substrate-binding residuesStructure-function relationshipsIdentifies critical residues for substrate specificity

A particularly effective strategy combines genetic screening with structural biology. Researchers have successfully established a matrix of sample conditions using combinations of potential substrate molecules (GSH, GSSG, L-Cys, CSSC, and heme), different nucleotides (ATP, ADP, ADP+Vi, and AMP-PNP), and rationally designed CydDC mutants . This comprehensive approach has yielded 39 individual structures under 22 different conditions, providing unprecedented insights into substrate recognition and specificity .

For practical implementation, researchers should first establish a chemically defined minimal medium (cdMIc) system that supports growth only when supplemented with specific substrate sources, such as cystine or GSSG . This creates a powerful selection system for identifying mutants with altered substrate specificity. Following this genetic screening, promising candidates can be characterized biochemically and structurally to define the molecular basis of substrate recognition.

What are the methodological challenges in expressing and purifying functional recombinant CydD?

Expressing and purifying functional recombinant CydD presents several methodological challenges that researchers must address to obtain biologically relevant results. These challenges stem from CydD's nature as an integral membrane protein and its function within a multi-component transport complex.

The primary challenges include:

  • Membrane protein expression: As an integral membrane protein, CydD contains multiple transmembrane helices that must be properly inserted into the membrane for functionality. Standard expression systems often yield misfolded or aggregated protein when overexpressing membrane proteins.

  • Complex formation requirements: CydD functions as part of the CydDC complex, and isolation of CydD alone may not capture its native conformation or functionality. Expression strategies must consider whether to co-express partner proteins or develop methods to study CydD in isolation.

  • Detergent selection: Extracting CydD from membranes requires detergents that maintain protein folding and function. The choice of detergent significantly impacts structural integrity and activity.

To overcome these challenges, researchers have developed an integrated approach using E. coli as a model system for expression and purification . This approach involves:

  • Optimizing expression constructs with appropriate affinity tags for purification

  • Screening multiple detergents for efficient solubilization while maintaining function

  • Implementing quality control measures to assess proper folding and oligomeric state

  • Developing activity assays compatible with detergent-solubilized protein

For structural studies, recent advances in nanodisc technology and amphipol stabilization have provided alternatives to traditional detergent micelles, enabling the study of CydD in a more native-like lipid environment . These approaches have successfully yielded samples suitable for high-resolution cryo-EM studies, resulting in structures at resolutions of 2.7 to 3.9 Å .

How does the CydD transmembrane domain architecture contribute to substrate selectivity?

The architecture of CydD's transmembrane domains plays a critical role in determining substrate selectivity through specific structural features that create a defined binding pocket and transport pathway. Detailed structural analysis reveals several key aspects of this architecture:

The membrane-accessible substrate entry site of CydDC is primarily controlled by the conformational plasticity of CydD transmembrane helix 4 (TM4) . This helix serves as a dynamic gate that regulates access to the substrate binding pocket, with its extended cytoplasmic segment coupling substrate binding to nucleotide-binding domain movements .

For substrates like heme, binding occurs laterally from the membrane space to the transmembrane region, facilitated by a highly asymmetrical inward-facing conformation of CydDC . During the binding process, substrate functional groups (such as heme propionates) interact with positively charged residues on the surface and within the binding pocket, which can cause reorientation of the substrate . For example, heme undergoes a 180-degree flip during the binding process, demonstrating how the architecture guides substrate positioning .

The substrate selectivity of CydD is further demonstrated by growth complementation studies showing that disruption of CydD (HI1187) renders H. influenzae unable to utilize GSSG as a cysteine source while maintaining the ability to use cystine . This selective defect indicates that the transmembrane architecture creates a binding pocket with specific structural requirements that distinguish between related substrates.

In the context of the full CydDC complex, mutational analysis and structural studies have shown that the substrate translocation pathway is formed at the interface between CydD and CydC transmembrane domains, with asymmetric contributions from each component . This arrangement creates a pathway with unique electrostatic and steric properties that determine which molecules can be transported.

What techniques are most effective for analyzing CydD-substrate interactions?

Analyzing CydD-substrate interactions requires a combination of complementary techniques that provide insights at different levels of resolution. The most effective methodological approach incorporates both in vivo functional assays and in vitro biophysical techniques:

TechniqueApplicationData OutputResolution Level
Growth-based assaysFunctional validation of substrate transportGrowth rates in substrate-limited mediaPhysiological relevance
Competition assaysSubstrate specificity determinationInhibition profilesRelative binding affinities
Isothermal Titration Calorimetry (ITC)Direct measurement of binding thermodynamicsBinding constants, enthalpy, entropyQuantitative binding parameters
Surface Plasmon Resonance (SPR)Real-time binding kineticsAssociation/dissociation ratesBinding kinetics
Cryo-EMStructural visualization of substrate-bound states3D structures at near-atomic resolutionAtomic-level interactions
Molecular Dynamics SimulationsDynamic interactions and energeticsBinding energies, conformational changesAtomistic behavior

For practical implementation, researchers have successfully employed growth complementation assays using chemically defined minimal medium (cdMIc) supplemented with different potential substrates . This approach provides a physiologically relevant readout of substrate utilization. For example, studies have demonstrated that H. influenzae with mutations in CydD (HI1187) can grow on cystine-supplemented media but not on GSSG-supplemented media, confirming the specificity of this transporter .

More detailed analysis has been achieved through competitive inhibition experiments, where candidate ligands are tested for their ability to inhibit growth in GSSG-supplemented media . This approach has revealed structural features required for substrate recognition, with specific peptides showing inhibitory effects at 3 mM concentration .

At the highest resolution level, systematic single-particle cryo-EM combined with atomistic molecular dynamics simulations has provided detailed insight into the conformational landscape of CydDC during substrate binding and translocation . This approach has yielded 39 individual structures under 22 different sample conditions, capturing different states of the transport cycle .

How can researchers design effective mutagenesis strategies to study CydD function?

Designing effective mutagenesis strategies for studying CydD function requires a systematic approach that targets specific structural and functional elements of the protein. Based on current research methodologies, the following framework provides optimal results:

  • Selection of mutagenesis approach:

    • For initial identification of essential genes, transposon mutagenesis provides an unbiased genome-wide approach. This technique has successfully identified CydD (HI1187) in H. influenzae through screening of approximately 12,000 kanamycin-resistant insertion mutants .

    • For targeted disruption of specific genes, homology-based insertion/disruption mutagenesis offers precise control. This approach has been used to create single insertion/disruption mutants like HI0853::Cm and HI0213::Zeo for functional characterization .

  • Target selection strategy:

    • Structure-guided mutagenesis: Using available structural data from cryo-EM studies (2.7-3.9 Å resolution), researchers can target specific residues involved in substrate binding or conformational changes .

    • Sequence conservation analysis: Comparing CydD sequences across species identifies evolutionarily conserved residues likely crucial for function.

    • Functional domain targeting: Focus on the ATP-binding sites, substrate-binding pocket, or transmembrane helices involved in conformational changes (particularly transmembrane helix 4) .

  • Validation methodology:

    • Complementation testing: Expressing wild-type CydD in mutant backgrounds confirms that phenotypes result from specific mutations rather than polar effects .

    • Growth phenotype analysis: Using chemically defined minimal medium (cdMIc) supplemented with different substrates (GSSG versus cystine) provides functional readouts of transporter activity .

    • Structural analysis: For advanced studies, purifying mutant proteins for cryo-EM analysis can directly visualize how mutations affect conformational states .

A particularly effective strategy involves creating a matrix of rationally designed mutant variants combined with different substrate and nucleotide conditions. This approach has yielded 39 individual structures of CydDC under 22 different sample conditions, providing comprehensive insight into structure-function relationships .

When implementing this strategy, researchers should consider potential polar effects on neighboring genes, especially since CydD functions as part of a complex with other components. Controls should include complementation studies and verification that the mutation affects only the targeted transport pathway .

What are the current limitations in CydD research and how might they be addressed?

Current research on H. influenzae CydD faces several methodological and conceptual limitations that constrain our understanding of this important transport protein. Addressing these limitations requires innovative approaches and technological advancements:

By addressing these limitations through the proposed methodological advancements, researchers can develop a more comprehensive understanding of CydD's role in H. influenzae physiology and pathogenesis, potentially opening new avenues for therapeutic intervention targeting this essential transport system.

How can understanding CydD function contribute to developing new antimicrobial strategies?

Understanding CydD function offers significant potential for developing novel antimicrobial strategies against Haemophilus influenzae and potentially other bacterial pathogens. This transport protein represents an attractive drug target for several key reasons:

  • Essential role in bacterial survival: H. influenzae is a glutathione auxotroph, meaning it cannot synthesize glutathione and relies on import via the CydDC transport system . Complete loss of growth observed in CydD mutants (HI1187 transposon mutant or the HI0853::Cm insertion mutant) demonstrates that this transporter is the only route available to H. influenzae for GSSG uptake across the inner membrane . This essentiality makes CydD an attractive target for antimicrobial development.

  • Structural insights enabling rational drug design: High-resolution structural data from cryo-EM studies (2.7-3.9 Å) has revealed detailed conformational states of the CydDC complex during substrate binding and transport . This structural information provides a foundation for structure-based drug design targeting critical conformational transitions or substrate binding sites.

  • Unique substrate specificity: The substrate specificity of the CydD-containing transporter differs from human transporters, offering potential selectivity for antimicrobial agents. Studies have identified specific peptides that can inhibit GSSG transport at 3 mM concentration while remaining non-toxic in growth experiments using cystine-supplemented media . These peptides could serve as starting points for developing more potent inhibitors.

Potential antimicrobial strategies targeting CydD include:

StrategyMechanismAdvantageDevelopment Approach
Competitive inhibitorsBlock substrate binding siteDirect inhibition of essential nutrient uptakeDesign based on known substrates like GSSG
Conformational locksPrevent transmembrane domain movementsFreezes transporter in inactive conformationTarget the flexible TM4 region
Allosteric modulatorsDisrupt coupling between NBDs and TMDsMay avoid resistance developmentFocus on cytoplasmic segment of TM4
Nucleotide-binding site inhibitorsPrevent ATP binding/hydrolysisLeverages well-characterized ABC transporter mechanismsDesign based on ATP binding pocket structure

Preliminary data supporting this approach comes from studies showing that specific peptides can inhibit growth in GSSG-supplemented media without affecting growth in cystine-supplemented media . This selective inhibition demonstrates the feasibility of targeting this transport system without causing general toxicity.

What methodological approaches can be used to study CydD in the context of bacterial pathogenesis?

Understanding the role of CydD in bacterial pathogenesis requires specialized methodological approaches that bridge molecular mechanisms and infection biology. The following research framework provides effective strategies for investigating CydD's contribution to H. influenzae virulence:

  • In vivo infection models:

    • Infant rat model: This established model for H. influenzae infection can be used to compare the virulence of wild-type strains versus CydD mutants .

    • Human respiratory tissue models: Ex vivo airway epithelial cultures provide a physiologically relevant system to study H. influenzae colonization and persistence.

    • Methodology: Comparative analysis of bacterial loads, inflammation markers, and tissue damage between wild-type and CydD-mutant infections.

  • Host-pathogen interaction studies:

    • Intracellular survival assays: Since H. influenzae can invade epithelial cells, measuring survival of CydD mutants within host cells provides insight into the role of glutathione import during intracellular phases.

    • Oxidative stress response: Analysis of how CydD contributes to bacterial survival during respiratory burst from immune cells.

    • Methodology: Flow cytometry-based assays measuring bacterial survival following exposure to oxidative stress, with and without glutathione supplementation.

  • Genetic approaches in infection settings:

    • Conditional expression systems: Develop inducible CydD expression to evaluate the timing of CydD requirement during different infection phases.

    • In vivo transcriptomics: RNA-seq analysis of bacterial gene expression during infection, comparing wild-type and CydD mutants.

    • Methodology: Dual RNA-seq capturing both host and bacterial transcriptomes during infection to identify CydD-dependent pathways.

  • Bacterial physiology under host-like conditions:

    • Growth in physiological fluids: Evaluate CydD mutant growth in human serum or respiratory mucus compared to laboratory media.

    • Biofilm formation: Assess the contribution of CydD to biofilm development and persistence.

    • Methodology: Microscopy and viable count assays measuring bacterial growth and survival under various physiological conditions.

  • Metabolomic approaches:

    • In vivo metabolite profiling: Compare metabolite profiles of wild-type and CydD mutant bacteria during infection.

    • Host metabolic changes: Analyze how CydD-dependent bacterial metabolism affects host cell metabolic states.

    • Methodology: LC-MS/MS analysis of bacterial and host metabolites during infection.

The importance of these approaches is highlighted by the fact that H. influenzae strain Rd, commonly used in laboratory studies, is a nonencapsulated, nonpathogenic derivative of a serotype d strain with a genome approximately 270 kb smaller than virulent type b strains . Therefore, findings from Rd must be validated in clinically relevant strains to ensure translational relevance.

How do variations in CydD structure and function across bacterial species impact therapeutic targeting strategies?

Variations in CydD structure and function across bacterial species create both challenges and opportunities for developing broad-spectrum or species-specific therapeutic targeting strategies. Understanding these variations is critical for rational drug design and predicting potential resistance mechanisms:

The systematic structural biology approach that has yielded 39 individual structures of CydDC under 22 different sample conditions provides an excellent foundation for comparative studies across species . Expanding this approach to CydD homologs from diverse pathogens would create a comprehensive structural database to guide therapeutic development.

What emerging technologies will advance our understanding of CydD transport mechanisms?

Several cutting-edge technologies are poised to revolutionize our understanding of CydD transport mechanisms in the coming years. These methodological advances will enable researchers to address longstanding questions about the dynamics, energetics, and regulation of this essential transport system:

  • Time-resolved cryo-electron microscopy (TR-cryo-EM):
    This emerging technology allows researchers to capture transient conformational states during the transport cycle. By applying rapid mixing and freezing techniques with millisecond-to-second time resolution, researchers can obtain "molecular movies" of CydD in action. This approach would significantly advance our understanding beyond the current static structures obtained through conventional cryo-EM, which has already provided 39 individual structures at resolutions of 2.7 to 3.9 Å . TR-cryo-EM could reveal short-lived intermediates in the transport cycle that are currently inaccessible.

  • Single-molecule techniques:
    Single-molecule FRET (smFRET) and high-speed atomic force microscopy (HS-AFM) offer unprecedented insights into the dynamics of individual transporter molecules. These approaches can reveal heterogeneity in transport behavior that is obscured in ensemble measurements. For CydD, these techniques could resolve the ongoing debate about whether hydrolysis occurs at both ATP-binding sites or just one site per transport cycle , by directly observing conformational changes in real-time during substrate transport.

  • Advanced MD simulations with enhanced sampling:
    The integration of experimental structures with enhanced sampling molecular dynamics techniques (such as metadynamics or umbrella sampling) allows researchers to calculate the energetics of conformational transitions and substrate binding. For CydD, these approaches can map the complete free energy landscape of transport, identifying energy barriers and rate-limiting steps in the process. Current research has already begun implementing atomistic MD simulations based on cryo-EM structures to characterize the function of CydDC at the atomic level .

  • Native mass spectrometry (native-MS):
    This technique can analyze membrane protein complexes in near-native states, revealing subunit stoichiometry, lipid interactions, and binding of substrates or nucleotides. For CydD research, native-MS could identify previously unknown interaction partners or regulatory molecules that modulate transporter function in different physiological contexts.

  • CRISPR-based genetic screens:
    High-throughput CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) screens can systematically identify genes that interact with CydD or modulate its function. These approaches could uncover novel regulatory pathways controlling CydD expression or activity in response to cellular needs, expanding our understanding beyond the current knowledge focused primarily on the direct transport mechanism.

The implementation of these technologies would build upon the current methodological framework that combines genetics, biochemistry, and structural biology. The matrix-based approach that has already yielded multiple structures under different conditions (substrates, nucleotides, and mutant variants) provides an excellent foundation for integrating these emerging technologies to develop a comprehensive model of CydD transport dynamics.

How might synthetic biology approaches be used to engineer CydD for biotechnological applications?

Synthetic biology offers innovative approaches to engineer CydD for various biotechnological applications by exploiting its transport capabilities and substrate specificity. These engineered systems could address challenges in biomanufacturing, environmental remediation, and biosensing:

By leveraging the detailed structural and functional data available for CydD, particularly the 39 individual structures under 22 different conditions , researchers can develop precisely engineered transport systems for diverse biotechnological applications.

What computational approaches show promise for predicting CydD-substrate interactions and inhibitor design?

Advanced computational approaches are increasingly valuable for predicting CydD-substrate interactions and designing effective inhibitors. These methods leverage growing structural data and algorithmic innovations to accelerate the discovery process:

  • Structure-based virtual screening and molecular docking:
    Utilizing the high-resolution structures obtained from cryo-EM studies (2.7-3.9 Å) , researchers can employ molecular docking to screen large virtual libraries of compounds for potential binders to CydD. This approach is particularly powerful when targeting specific conformational states of the transporter:

    • Ensemble docking: Screening compounds against multiple conformational states captured in the 39 individual structures of CydDC to identify ligands that preferentially bind to specific states.

    • Induced-fit docking: Accounting for protein flexibility during ligand binding, especially important given the conformational plasticity of CydD transmembrane helix 4 .

    • Fragment-based approaches: Identifying small molecular fragments that bind to different sites within the substrate-binding pocket, which can later be linked to create high-affinity inhibitors.

  • Molecular dynamics (MD) simulations and free energy calculations:
    MD simulations provide dynamic insights beyond static structures, revealing transient interactions and conformational changes:

    • Binding free energy calculations: Methods such as MM/PBSA (Molecular Mechanics Poisson-Boltzmann Surface Area) or FEP (Free Energy Perturbation) can predict binding affinities of substrates or inhibitors with greater accuracy than docking alone.

    • Enhanced sampling techniques: Approaches such as metadynamics or umbrella sampling help overcome energy barriers in simulations, allowing exploration of the complete transport cycle.

    • Coarse-grained simulations: These enable simulation of the entire CydDC complex in a lipid bilayer over longer timescales, capturing large-scale conformational changes during substrate transport.

  • Machine learning and AI-driven approaches:
    The growing structural and functional data on CydD creates opportunities for machine learning applications:

    • Deep learning for binding prediction: Neural networks trained on known CydD-substrate interactions can predict binding of novel compounds and guide inhibitor design.

    • Generative models: AI approaches that can generate novel molecular structures optimized for binding to specific CydD conformations.

    • Quantum mechanical methods: For accurate modeling of electronic interactions in the binding pocket, especially important for designing transition-state analogs that target the ATP hydrolysis mechanism.

  • Systems biology modeling:
    Moving beyond the isolated protein to understand CydD in its cellular context:

    • Metabolic flux analysis: Predicting how inhibition of CydD would impact cellular metabolism in H. influenzae, identifying potential synergistic targets.

    • Pharmacokinetic/pharmacodynamic (PK/PD) modeling: Integrating molecular-level inhibition data with whole-cell and organism-level effects to predict efficacy of potential therapeutics.

  • Implementation strategy for inhibitor design:
    An integrated computational workflow combining these approaches would include:

    Computational StageMethodsExpected Outcomes
    Target site identificationMD simulations, binding hotspot analysisKey residues and pockets for inhibitor design
    Virtual screeningStructure-based docking against diverse conformationsInitial hit compounds with predicted binding modes
    Binding affinity refinementFree energy calculations (FEP, MM/PBSA)Prioritized compounds with accurate affinity predictions
    Lead optimizationAI-guided structure generation, fragment growingNovel compounds with improved properties
    Resistance predictionMD simulations of mutant variantsRobustness against potential resistance mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.