Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Haemophilus influenzae ATP synthase subunit a (atpB) is a full-length, His-tagged protein produced in Escherichia coli. It corresponds to residues 1–262 of the native ATP synthase subunit a, encoded by the atpB gene (UniProt ID: A5UA05 or P43719, depending on strain) . ATP synthase is a membrane-bound enzyme complex responsible for ATP synthesis via oxidative phosphorylation. Subunit a forms part of the F0 sector, which facilitates proton translocation across the membrane to drive ATP production .

Expression System

  • Host: E. coli (most common), with alternatives in yeast, baculovirus, or mammalian cells .

  • Yield: High-level expression due to optimized codon usage for prokaryotic systems .

Purification and Quality Control

  • Purity: >85–90% verified by SDS-PAGE .

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Solubilized in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Applications in Research

  • Enzyme Kinetics: Used to study proton translocation mechanisms in ATP synthase .

  • Vaccine Development: Explored as a potential antigen for H. influenzae vaccines (non-human use only) .

  • Structural Biology: Facilitates cryo-EM and X-ray crystallography studies of F0 sector assembly .

Functional Insights

  • Proton Channel Role: Subunit a collaborates with subunit c (atpE) to form a transmembrane proton pathway, critical for ATP synthesis . Mutations in atpB disrupt proton flow, impairing bacterial growth .

  • Conservation Across Strains: Homologs in H. influenzae PittEE and PittGG strains share >99% sequence identity, underscoring structural stability .

Comparative Analysis

  • Species-Specific Variations: H. influenzae atpB shares 70–80% homology with E. coli and Streptococcus pneumoniae homologs, but key residue differences affect inhibitor binding .

Table 3: Amino Acid Sequence (Partial)

ResiduesSequence Segment
1–20MFGQTTSEYISHHLSFLKTGD
50–70GVPGKMQCLVEIVVEWVNGIVK
240–262TVVYLSIAYNKADH
Full sequence available in .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; NTHI0615; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
atpB
Target Protein Sequence
MSGQTTSEYISHHLSFLKTGDGFWNVHIDTLFFSILAAVIFLFVFSRVGKKATTGVPGKM QCLVEIVVEWVNGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQFAGLFGI HYLRAVPTADISATLGMSICVFFLILFYTIKSKGFKGLVKEYTLHPFNHWAFIPVNFILE TVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFHILVITL QAFIFMMLTVVYLSIAYNKADH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: hit:NTHI0615

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) in Haemophilus influenzae?

ATP synthase subunit a (atpB) is a critical component of the F0 sector of ATP synthase in Haemophilus influenzae. It consists of 262 amino acids and functions as part of the membrane-embedded proton channel that facilitates ATP synthesis. The protein is encoded by the atpB gene (also known as NTHI0615) and is synonymous with F-ATPase subunit 6 . The protein's primary sequence contains multiple transmembrane domains that anchor it within the bacterial membrane, where it participates in the rotary mechanism of ATP production by facilitating proton translocation.

How does recombinant atpB differ from native Haemophilus influenzae atpB?

The commercially available recombinant Haemophilus influenzae ATP synthase subunit a (atpB) is produced in E. coli expression systems with an N-terminal histidine tag (His-tag). While the core protein sequence (residues 1-262) remains identical to the native form, the addition of the His-tag modifies the protein in several important ways:

FeatureNative atpBRecombinant His-tagged atpB
N-terminal modificationNone6-8 histidine residues
Expression systemH. influenzaeE. coli
Post-translational modificationsNative bacterial modificationsMay lack some modifications present in native protein
Purification characteristicsRequires complex isolationSimplified purification via metal affinity chromatography
Structural integrityComplete native foldingGenerally preserves native structure with minimal tag interference
Molecular weight~29 kDa~30-31 kDa (depending on tag length)

The recombinant protein maintains greater than 90% purity as determined by SDS-PAGE and retains functional characteristics similar to the native protein while offering significant advantages for laboratory manipulation and analysis .

What are the optimal storage conditions for recombinant Haemophilus influenzae atpB?

For long-term stability and activity preservation of recombinant Haemophilus influenzae ATP synthase subunit a (atpB), the following storage protocol is recommended:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50%

  • Aliquot the protein solution to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For extended storage periods, maintain aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they significantly degrade protein quality

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which enhances stability during freeze-thaw processes. Proper storage is critical as repeated freeze-thaw cycles can lead to protein denaturation and loss of functional activity.

How should recombinant Haemophilus influenzae atpB be reconstituted for experimental use?

The recommended reconstitution protocol for lyophilized recombinant Haemophilus influenzae ATP synthase subunit a (atpB) involves several key steps to ensure optimal protein activity:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (or between 5-50% based on experimental requirements)

  • Gently mix by inversion or slow pipetting to avoid protein denaturation

  • Allow the protein to rehydrate completely for 15-30 minutes at room temperature

  • Aliquot into small volumes to minimize freeze-thaw cycles

  • Verify protein concentration using standard protein assays (Bradford or BCA)

Following this protocol maximizes protein stability and biological activity for downstream applications.

What techniques are most effective for analyzing atpB function in vitro?

Several complementary techniques prove effective for analyzing the function of ATP synthase subunit a (atpB) in vitro:

TechniqueApplicationAdvantagesLimitations
Site-directed mutagenesisStructure-function relationship studiesPrecise modification of key residuesRequires knowledge of important residues
Reconstitution into liposomesProton translocation assaysMimics native membrane environmentTechnical complexity in preparation
ATP synthesis assaysDirect functional assessmentQuantitative measurement of activityRequires intact ATP synthase complex
Fluorescence-based proton flux assaysReal-time monitoring of proton movementHigh sensitivity and temporal resolutionPotential interference from fluorophores
Cryo-EM analysisStructural characterizationHigh-resolution structural informationRequires specialized equipment and expertise

For proton translocation studies specifically, pH-sensitive fluorescent dyes (such as ACMA or pyranine) can be incorporated into proteoliposomes containing reconstituted atpB. This allows real-time monitoring of proton movement across the membrane in response to various conditions or inhibitors .

How can atpB be used as a target for antimicrobial development against Haemophilus influenzae?

ATP synthase subunit a (atpB) represents a promising antimicrobial target against Haemophilus influenzae due to its essential role in energy production and several exploitable characteristics:

  • Target validation approach:

    • Conduct mutagenesis studies to identify essential residues for function

    • Perform growth inhibition assays with known ATP synthase inhibitors (e.g., oligomycin derivatives)

    • Develop ATP synthase activity assays in membrane preparations to screen compound libraries

  • Rational drug design strategy:

    • Focus on the unique aspects of the proton channel region

    • Target the interface between atpB and other F0 subunits

    • Exploit structural differences between bacterial and human ATP synthases

  • Experimental validation pipeline:

PhaseMethodologyExpected OutcomesConsiderations
Initial screeningIn silico docking to atpB structureIdentification of binding candidatesRequires accurate structural model
Binding validationSurface plasmon resonance or isothermal titration calorimetryQuantitative binding parametersNeeds purified, stable protein
Functional inhibitionATP synthesis assays in bacterial membranesDose-dependent inhibition curvesComplex assay system
Cell-based testingGrowth inhibition assays with H. influenzaeMIC and selectivity indexPermeability challenges
Resistance developmentSerial passage with sub-MIC concentrationsIdentification of resistance mechanismsTime-intensive

The unique structure of bacterial ATP synthase compared to mammalian homologs offers potential selectivity windows for antimicrobial development. Recent structural studies using cryo-EM have provided insights into the molecular architecture of bacterial ATP synthases, which can inform structure-based drug design efforts .

What role does atpB play in Haemophilus influenzae virulence and pathogenesis?

While ATP synthase is primarily associated with energy metabolism, emerging research suggests atpB may contribute to Haemophilus influenzae virulence through several mechanisms:

  • Energy provision for virulence factor expression:

    • ATP synthase activity maintains adequate ATP levels required for the expression and function of virulence factors

    • Reduced ATP synthase function leads to attenuated virulence in infection models

  • Adaptation to microenvironments:

    • atpB functionality is critical for bacterial survival under oxygen-limited conditions in host tissues

    • Modulation of ATP synthase activity allows adaptation to pH changes encountered during infection

  • Potential non-canonical functions:

    • Some ATP synthase components may moonlight as adhesins or immunomodulatory factors

    • Surface exposure of ATP synthase components has been documented in some bacterial pathogens

  • Interaction with host defense mechanisms:

    • ATP synthase activity influences bacterial susceptibility to host-derived antimicrobial peptides

    • Maintenance of membrane potential via ATP synthase affects resistance to complement-mediated killing

Experimental approaches to study these connections include:

  • Comparative virulence studies with atpB mutants in appropriate infection models

  • Transcriptomic and proteomic analyses of atpB expression under host-mimicking conditions

  • Investigation of potential protein-protein interactions between atpB and host factors

The connection between energy metabolism and virulence represents an emerging area that may provide new therapeutic approaches against H. influenzae infections .

How can meta-analysis techniques be applied to atpB research across different bacterial species?

Meta-analysis of ATP synthase subunit a (atpB) research across bacterial species can provide valuable insights into evolutionary conservation, functional diversity, and structure-function relationships. Following the methodology outlined in the literature, researchers can implement a systematic approach:

  • Systematic literature search strategy:

    • Define precise inclusion criteria (experimental methods, data reporting standards)

    • Search multiple databases with standardized terms related to bacterial ATP synthases

    • Screen results following PRISMA guidelines with defined eligibility criteria

  • Data extraction and standardization:

    • Extract sequence data, functional parameters, and structural information

    • Standardize functional measures (e.g., ATP synthesis rates, proton translocation efficiencies)

    • Document experimental conditions to account for methodological heterogeneity

  • Meta-analytic workflow for atpB research:

StepDescriptionMethodologyOutcome
Data collectionGather primary research on atpB from multiple speciesSystematic review following PRISMA guidelinesComprehensive dataset of atpB sequences and functional data
Effect size calculationConvert findings to standardized metricsHedge's g or similar standardized measuresComparable measures across studies
Heterogeneity assessmentEvaluate variability across studiesI² statistic, Q-testUnderstanding of data consistency
Meta-regressionIdentify factors affecting atpB functionRandom-effects models with moderator variablesFactors influencing functional parameters
Publication bias assessmentCheck for reporting biasesFunnel plots, Egger's testEvaluation of literature comprehensiveness
  • Application of computational tools:

    • Utilize specialized software like MetaLab for integrating diverse datasets

    • Implement phylogenetic meta-analysis to account for evolutionary relationships

    • Develop visualization tools to represent functional conservation across species

This approach can reveal conserved functional regions across bacterial ATP synthases, identify species-specific adaptations, and guide future experimental design by highlighting knowledge gaps in the field.

How can researchers accurately measure intracellular ATP concentrations in studies involving atpB?

Accurate measurement of intracellular ATP concentrations is crucial for understanding the functional impact of ATP synthase modifications. Multiple complementary approaches can be employed:

  • Luciferase-based assays:

    • Most common method utilizing the ATP-dependent luciferin-luciferase reaction

    • Sample preparation must include rapid cell lysis to prevent ATP degradation

    • Standard curves must be prepared in matrices matching the experimental samples

    • Results should be normalized to cell number or protein content

  • HPLC-based methods:

    • Offers higher specificity and ability to simultaneously measure ADP and AMP

    • Requires more specialized equipment but provides absolute quantification

    • Ion-pairing reverse-phase chromatography with UV detection at 260 nm is standard

    • Sample preparation involves perchloric acid extraction followed by neutralization

  • Considerations for experimental design:

ParameterRecommendationRationale
Sampling timingImmediate processing or flash-freezingATP turnover is rapid (seconds)
Extraction methodTrichloroacetic acid (TCA) or perchloric acidInactivates ATPases instantly
ControlsInclude ATP recovery standardsAccounts for degradation during processing
NormalizationCellular protein or DNA contentAllows comparison between different samples
Biological replicatesMinimum n=5 recommendedAccounts for biological variability
  • Expected values and variability:
    Based on meta-analysis of published data, typical intracellular ATP concentrations in bacterial cells range from 1-5 mM, with coefficients of variation between 15-30% across biological replicates . Studies specifically examining H. influenzae should consider that ATP levels can vary significantly based on growth phase and environmental conditions.

  • Data interpretation challenges:

    • Distinguish between effects on ATP synthesis versus consumption

    • Consider compartmentalization effects in different cellular regions

    • Account for potential compensatory mechanisms when atpB function is altered

These methodological considerations ensure reliable data generation when studying the impact of atpB function on cellular energetics.

What statistical approaches are most appropriate for analyzing experimental data from atpB functional studies?

The appropriate statistical analysis of ATP synthase subunit a (atpB) functional data requires careful consideration of experimental design, data distribution, and research questions. Based on meta-analytic approaches from the literature, the following statistical framework is recommended:

  • Preliminary data assessment:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Evaluate homogeneity of variances with Levene's test

    • Identify potential outliers using standardized residuals or Cook's distance

  • Comparative analyses for different experimental designs:

Experimental DesignRecommended TestNon-parametric AlternativeEffect Size Measure
Two independent groupsStudent's t-testMann-Whitney U testCohen's d
Multiple independent groupsOne-way ANOVA with post-hoc testsKruskal-Wallis with Dunn's testη² (eta squared)
Factorial designsTwo-way ANOVAAligned rank transform ANOVAPartial η²
Repeated measuresRM-ANOVAFriedman testω² (omega squared)
Correlation studiesPearson correlationSpearman's rank correlationr or r²
  • Advanced statistical approaches for complex datasets:

    • Mixed-effects models for nested experimental designs

    • ANCOVA when controlling for covariates like protein expression levels

    • Meta-regression to explore sources of heterogeneity across experiments

  • Power analysis and sample size determination:

    • A priori power calculations based on expected effect sizes from literature

    • Recommended power of 0.8 or higher with alpha = 0.05

    • Post-hoc power analysis to interpret negative results

  • Reporting guidelines:

    • Include all statistical parameters (test statistic, degrees of freedom, exact p-values)

    • Report confidence intervals alongside point estimates

    • Clearly state any data transformations or exclusion criteria

    • Use appropriate visualization methods (box plots for distribution, forest plots for meta-analysis)

Following these statistical approaches ensures robust interpretation of atpB functional data and facilitates comparison across different studies and experimental systems.

How can researchers reconcile contradictory data regarding atpB function across different experimental systems?

Reconciling contradictory findings regarding ATP synthase subunit a (atpB) function is a common challenge due to variations in experimental systems, conditions, and methodologies. A systematic approach to addressing these contradictions includes:

  • Methodological standardization:

    • Develop standardized protocols for protein preparation and functional assays

    • Document detailed experimental conditions (pH, temperature, ionic strength)

    • Establish reference standards for comparison across laboratories

  • Sources of experimental variability to consider:

Variable FactorPotential ImpactMitigation Strategy
Expression systemPost-translational modificationsCompare E. coli and H. influenzae native systems
Membrane environmentLipid composition affects functionStandardize reconstitution protocols
Protein tagsMay interfere with protein interactionsTest both tagged and untagged versions
Assay conditionspH and ion concentrations affect activityPerform activity profiles across conditions
Protein preparationDetergent choice affects stabilityCompare multiple purification approaches
  • Meta-analytical approach to contradictory data:

    • Apply forest plot visualization to compare effect sizes across studies

    • Conduct sensitivity analyses excluding methodologically divergent studies

    • Use funnel plots to identify potential publication or reporting biases

    • Apply heterogeneity statistics (I² and Q-test) to quantify inconsistency

  • Integrative data interpretation framework:

    • Distinguish between truly contradictory findings versus context-dependent differences

    • Develop mechanistic models that can accommodate seemingly contradictory results

    • Identify experimental parameters that consistently predict functional outcomes

    • Design crucial experiments specifically targeted at resolving contradictions

  • Collaborative approaches:

    • Organize multi-laboratory validation studies with standardized protocols

    • Establish data repositories for sharing raw experimental data

    • Implement Bayesian methods to integrate prior knowledge with new findings

This systematic approach not only helps reconcile contradictory data but can lead to deeper insights into the context-dependent nature of atpB function and identify previously unrecognized regulatory mechanisms.

What are the common challenges in expressing and purifying recombinant Haemophilus influenzae atpB?

Expression and purification of recombinant ATP synthase subunit a (atpB) presents several technical challenges due to its hydrophobic nature and membrane integration. The following troubleshooting guide addresses common issues:

  • Expression challenges and solutions:

ChallengePotential CausesSolutions
Low expression levelsCodon bias, protein toxicityOptimize codons for E. coli, use regulated promoters, lower induction temperature to 16-18°C
Inclusion body formationRapid expression, improper foldingReduce induction strength, co-express with chaperones, add solubilizing agents
Proteolytic degradationRecognition by host proteasesUse protease-deficient strains, add protease inhibitors, optimize harvest timing
Growth inhibitionDisruption of host membranesUse C41(DE3) or C43(DE3) strains designed for membrane proteins
  • Purification optimization strategies:

    • Use mild detergents (DDM, LMNG) for membrane solubilization

    • Implement two-step purification (IMAC followed by size exclusion)

    • Consider on-column refolding for proteins recovered from inclusion bodies

    • Maintain detergent above critical micelle concentration throughout purification

    • Evaluate protein quality using SDS-PAGE and Western blotting at each step

  • Quality control assessments:

    • Circular dichroism to verify secondary structure elements

    • Size-exclusion chromatography to confirm monodispersity

    • Mass spectrometry to verify protein integrity and modifications

    • Functional assays in reconstituted systems to confirm activity

  • Reconstitution considerations:

    • Select lipid compositions that mimic H. influenzae membranes

    • Optimize protein-to-lipid ratios (typically 1:50 to 1:200 w/w)

    • Remove detergent gradually using Bio-Beads or dialysis

    • Verify correct orientation in liposomes using protease protection assays

The successful expression and purification of functional atpB typically requires iterative optimization of conditions specific to each laboratory's equipment and expertise. Commercial preparations provide standardized quality but may have limitations for specific research applications .

How can researchers troubleshoot inconsistent results in ATP synthase activity assays?

Inconsistent results in ATP synthase activity assays involving atpB can stem from multiple sources. The following systematic troubleshooting approach can help identify and resolve these issues:

  • Common sources of variability and solutions:

Source of VariabilityDiagnostic IndicatorsResolution Strategies
Protein qualityVariable specific activity between preparationsImplement rigorous quality control, standardize purification protocols
Reconstitution efficiencyInconsistent proton gradient formationStandardize proteoliposome preparation, measure protein incorporation
Assay componentsVariable baseline activity in controlsPrepare fresh reagents, validate ATP detection system
Membrane integrityHigh background activity, rapid gradient dissipationOptimize freeze-thaw procedures, validate liposomes with fluorescent dyes
Temperature fluctuationsActivity correlation with ambient temperatureUse temperature-controlled chambers, monitor temperature throughout
  • Procedural standardization checklist:

    • Establish internal controls and standards for each assay run

    • Document detailed protocols including reagent preparation

    • Implement quality control checkpoints at critical steps

    • Maintain consistent timing between steps

    • Control for environmental variables (light, temperature, vibration)

  • Advanced troubleshooting for complex assays:

    • Perform component-by-component validation of assay systems

    • Develop positive and negative controls for each assay variant

    • Implement spike recovery tests to identify matrix effects

    • Use orthogonal assay methods to confirm critical findings

  • Data analysis considerations:

    • Apply statistical process control principles to monitor assay performance

    • Establish acceptance criteria for technical replicates

    • Implement normalization procedures to account for batch effects

    • Consider Bayesian statistical approaches for highly variable systems

By systematically addressing these factors, researchers can significantly improve the reproducibility and reliability of ATP synthase activity assays involving recombinant Haemophilus influenzae atpB .

What approaches can be used to study the integration of recombinant atpB into functional ATP synthase complexes?

Studying the integration of recombinant ATP synthase subunit a (atpB) into functional ATP synthase complexes requires sophisticated approaches that address both structural incorporation and functional contribution. The following methodologies are particularly effective:

  • Complementation studies in genetic systems:

    • Generate conditional atpB mutants in model organisms

    • Express recombinant variants under controlled conditions

    • Assess restoration of growth phenotypes and ATP synthesis

    • Quantify ATP synthesis rates relative to wild-type controls

  • Biochemical approaches to verify complex assembly:

TechniqueApplicationAdvantagesConsiderations
Blue Native PAGEVisualization of intact complexesPreserves native interactionsLimited resolution of subcomplexes
Co-immunoprecipitationVerification of protein-protein interactionsCan detect transient interactionsRequires specific antibodies
FRET-based assaysReal-time monitoring of subunit proximityWorks in live cellsRequires fluorescent tagging
Chemical crosslinking with MSIdentification of interaction interfacesHigh spatial resolutionComplex data analysis
Cryo-EMStructural verification of integrationNear-atomic resolutionTechnically demanding
  • Functional validation approaches:

    • ATP synthesis assays in reconstituted systems or membrane preparations

    • Proton translocation measurements using pH-sensitive fluorophores

    • Rotation assays monitoring the mechanical function of the complex

    • Membrane potential measurements to assess proton gradient utilization

  • Quantitative assessment of incorporation efficiency:

    • Develop quantitative Western blotting protocols with recombinant standards

    • Implement absolute quantification using mass spectrometry (MRM/SRM)

    • Calculate stoichiometry ratios relative to other ATP synthase subunits

    • Correlate incorporation efficiency with functional recovery

  • Structural validation methods:

    • Site-specific crosslinking to verify correct positioning

    • Limited proteolysis to assess proper folding and exposure

    • Hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

    • Single-particle cryo-EM to visualize the intact complex architecture

These approaches collectively provide a comprehensive assessment of both the structural and functional integration of recombinant atpB into ATP synthase complexes, enabling detailed structure-function studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.