Recombinant Haemophilus influenzae ATP synthase subunit b (atpF)

What is the structure and function of ATP synthase subunit b (atpF) in Haemophilus influenzae?

ATP synthase subunit b (atpF) is a critical membrane protein component of the F-type ATP synthase complex in H. influenzae. The full-length protein consists of 156 amino acids with the sequence: MNLNATLIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKVQAQEILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL .

Functionally, atpF serves as part of the peripheral stalk in the F0 sector, providing structural support that connects the membrane-embedded F0 domain to the catalytic F1 domain. This connection is essential for maintaining the proper orientation and stability during the rotational catalysis process of ATP synthesis. The protein contains both transmembrane regions that anchor it in the cell membrane and cytoplasmic domains that interact with other ATP synthase components.

How does atpF in H. influenzae compare to homologs in other bacterial species?

While the core function of atpF is conserved across bacterial species, H. influenzae atpF exhibits some structural distinctions. Comparative sequence analysis reveals conservation of key functional domains required for ATP synthase assembly, but with species-specific variations in non-essential regions. These variations likely reflect adaptation to the specific membrane composition and energy requirements of H. influenzae.

A key distinction is that H. influenzae, as a host-adapted pathogen, has evolved its ATP synthase components to function optimally under the nutrient-limited conditions of its ecological niche. Unlike environmental bacteria that might require adaptability to varying conditions, H. influenzae atpF is specialized for function within the relatively stable environment of the human respiratory tract.

What are the optimal expression systems for recombinant H. influenzae atpF production?

The most effective expression system for recombinant H. influenzae atpF production is E. coli, as evidenced by multiple successful studies . Specifically, the following methodological approaches have proven successful:

Table 1: Comparative Expression Systems for Recombinant H. influenzae atpF

For optimal expression, researchers should consider using pET expression vectors with an N-terminal His-tag under the control of a T7 promoter in E. coli BL21(DE3) or C41(DE3) strains . Induction conditions should be optimized with IPTG concentrations of 0.1-0.5 mM at lower temperatures (16-25°C) to improve proper folding and reduce inclusion body formation.

What purification strategies yield the highest purity and activity of recombinant atpF?

The most effective purification strategy for H. influenzae atpF employs a multi-step approach:

• Membrane isolation: Differential centrifugation following cell lysis to separate membrane fractions containing the target protein.

• Detergent solubilization: Critical for extracting membrane proteins while maintaining native structure. Lauryl maltose neopentyl glycol (L-MNG) has shown superior results for maintaining stability compared to dodecyl-β-d-maltoside (DDM) . The concentration of detergent significantly affects the oligomeric state of membrane proteins, with higher L-MNG concentrations potentially altering the elution profile .

• Affinity chromatography: Nickel-NTA affinity chromatography for His-tagged recombinant atpF, with elution using an imidazole gradient (50-250 mM).

• Size exclusion chromatography: To separate oligomeric states and remove aggregates. The target protein typically elutes at specific volumes depending on its oligomeric state: monomeric forms around 65-67 mL and potential dimeric forms at 58 mL .

• Storage: Optimal storage should be in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What are the most effective techniques for structural analysis of H. influenzae atpF?

Structural analysis of membrane proteins like atpF requires specialized approaches due to their hydrophobic nature. The following techniques have proven most valuable:

Table 2: Structural Analysis Methods for H. influenzae atpF

Cryo-electron microscopy (cryo-EM) has emerged as a particularly powerful method for studying membrane proteins like ATP synthase components. Recent studies have achieved near-atomic resolution (2.2-3.0 Å) for related membrane proteins in amphipol environments . This technique allows visualization of the protein in a more native-like environment compared to crystallography.

How can researchers study the assembly of atpF into the ATP synthase complex?

Studying the assembly of atpF into the ATP synthase complex requires specialized approaches that preserve native interactions:

• Co-expression systems: Express atpF alongside other ATP synthase subunits in E. coli to allow native-like assembly.

• Pull-down assays: Use affinity-tagged atpF to identify interacting partners within the ATP synthase complex.

• Cross-linking mass spectrometry: Employ chemical cross-linkers followed by mass spectrometry to identify spatial relationships between atpF and other subunits.

• Fluorescence resonance energy transfer (FRET): Tag atpF and potential partner proteins with fluorophores to monitor assembly in real-time.

• Single-molecule techniques: Apply methods such as total internal reflection fluorescence microscopy (TIRFM) to observe individual assembly events.

Recent research has demonstrated that membrane proteins like transporters can form stable homodimeric structures, with lipids playing crucial roles at the dimer interface . Similar approaches could be applied to study atpF assembly, investigating whether lipids might stabilize interactions between atpF and other ATP synthase components.

What are the most reliable assays for measuring atpF functionality?

Assessing the functionality of recombinant atpF requires examining both its ability to properly integrate into the ATP synthase complex and its contribution to ATP synthesis activity:

• Reconstitution assays: Incorporation of purified atpF into liposomes or nanodiscs with other ATP synthase components to reconstruct functional complexes.

• ATP synthesis measurement: Monitoring ATP production using luciferase-based assays after reconstitution of complete ATP synthase complexes containing atpF.

• Proton translocation assays: Using pH-sensitive fluorescent dyes to monitor proton movement across membranes containing reconstituted ATP synthase.

• Binding affinity measurements: Determining the interaction strength between atpF and other subunits using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC). Research on related proteins has shown binding affinities in the micromolar range for protein-protein interactions within complexes .

• Thermal stability assays: Differential scanning fluorimetry to assess how mutations or conditions affect the stability of atpF alone or in complex with other subunits.

How does the membrane environment affect atpF function and stability?

The membrane environment critically influences atpF function and stability:

• Lipid composition effects: Different lipid compositions can significantly alter the stability and activity of membrane proteins like atpF. Recent studies on H. influenzae membrane proteins have identified specific lipids at protein interfaces that appear to stabilize oligomeric structures .

• Detergent selection: The choice of detergent during purification dramatically affects protein stability. For instance, L-MNG has been shown to provide better stability than DDM for some H. influenzae membrane proteins .

• Reconstitution systems: Nanodiscs, amphipols, and liposomes offer different advantages for functional studies:

  • Nanodiscs provide a defined lipid environment with access to both sides of the membrane

  • Amphipols stabilize membrane proteins in solution while maintaining native-like conformations

  • Liposomes enable assessment of transport and electrical properties across membranes

• Protein-lipid interactions: Specific lipid binding sites have been identified in the structures of some H. influenzae membrane proteins, suggesting that lipids may play structural roles beyond simply providing a hydrophobic environment .

How does atpF contribute to H. influenzae survival and pathogenesis?

As a component of ATP synthase, atpF plays a crucial role in energy production for H. influenzae. Several aspects of its contribution to bacterial physiology and pathogenesis include:

• Energy production: ATP synthase is essential for generating ATP through oxidative phosphorylation, providing energy for cellular processes critical for survival and pathogenesis.

• Adaptation to host environment: H. influenzae must adapt to nutrient-limited conditions within the human host. ATP synthase efficiency is critical for survival under these conditions.

• Response to environmental stresses: Changes in ATP synthase activity, potentially involving atpF, may help bacteria respond to pH changes, oxygen limitation, or antimicrobial challenges within the host.

• Potential virulence factor: While not directly a virulence factor, efficient energy production supports the expression of virulence factors and survival during infection.

• Connection to other metabolic pathways: ATP production interfaces with other essential pathways in H. influenzae, including those involved in acquiring essential nutrients like NAD (V-factor) from the host environment .

How do mutations in atpF affect H. influenzae viability and antimicrobial susceptibility?

Mutations in atpF can significantly impact bacterial viability and antibiotic responses:

• Structural integrity disruption: Mutations that disrupt the interaction between atpF and other ATP synthase subunits can compromise the structural integrity of the complex, reducing ATP production and bacterial viability.

• Proton translocation efficiency: Changes in the transmembrane regions of atpF could affect proton translocation efficiency, altering the proton motive force that drives ATP synthesis.

• Antimicrobial susceptibility: Altered ATP synthase function can affect membrane potential, potentially modifying susceptibility to antibiotics that target membrane integrity or rely on proton motive force for uptake.

• Metabolic adaptations: Bacteria with atpF mutations might upregulate substrate-level phosphorylation pathways to compensate for reduced oxidative phosphorylation, altering their metabolic profile and potentially their virulence.

• Growth rate effects: Reduced ATP synthesis efficiency typically results in slower growth rates, which can affect both in vitro culture characteristics and in vivo infection dynamics.

How can atpF be targeted for potential antimicrobial development?

The essential nature of ATP synthase makes atpF a potential target for novel antimicrobial development:

• Structure-based drug design: The detailed structural information available for ATP synthase components, including models of atpF, can guide the design of small molecules that specifically interfere with complex assembly or function.

• Natural product screening: Several natural products, including oligomycin and venturicidin, target ATP synthase in other organisms. Similar approaches could identify compounds specific to the H. influenzae ATP synthase.

• Peptide inhibitors: Designed peptides that mimic interaction surfaces of atpF could compete with native protein-protein interactions, disrupting ATP synthase assembly.

• Combination approaches: ATP synthase inhibitors might synergize with existing antibiotics by compromising bacterial energy production, reducing the ability of bacteria to maintain efflux pumps or repair mechanisms.

• Species-specific targeting: Structural differences between bacterial and human ATP synthase components could be exploited to develop antibiotics with minimal host toxicity.

What are the current analytical challenges in studying atpF interactions with other ATP synthase components?

Researchers face several challenges when studying interactions between atpF and other ATP synthase components:

• Membrane protein solubilization: Maintaining native-like conformations during extraction from membranes remains challenging. Recent advances with detergents like L-MNG show promise but require optimization for specific protein complexes .

• Capturing transient interactions: Many protein-protein interactions within ATP synthase are dynamic and may be lost during purification. Cross-linking approaches or rapid analysis techniques are needed to capture these interactions.

• Reconstitution of complete complexes: Full reconstitution of functional ATP synthase including atpF requires carefully optimized conditions that balance detergent concentration, lipid composition, and protein ratios.

• Heterologous expression limitations: When expressing individual components like atpF, proper folding may depend on interactions with other ATP synthase subunits, creating a circular problem for isolation and study.

• Structural heterogeneity: ATP synthase undergoes conformational changes during its catalytic cycle, resulting in structural heterogeneity that complicates structural analysis, particularly in cryo-EM studies.

How can systems biology approaches enhance our understanding of atpF in the context of H. influenzae metabolism?

Systems biology offers powerful frameworks for understanding atpF within broader metabolic contexts:

What role might post-translational modifications play in regulating atpF function?

Post-translational modifications (PTMs) could significantly regulate atpF function in H. influenzae:

• Phosphorylation: Potential phosphorylation sites in atpF could modulate its interactions with other ATP synthase components or affect complex assembly.

• Acetylation: Lysine acetylation has been identified in bacterial proteins and could alter the charge distribution in atpF, affecting its structural interactions.

• Oxidative modifications: Cysteine residues in atpF might undergo oxidation in response to oxidative stress, potentially serving as regulatory switches.

• Proteolytic processing: Limited proteolysis could generate functional variants of atpF with altered activities or interaction profiles.

• Methodological approaches: Mass spectrometry-based proteomics, particularly techniques like multiple reaction monitoring (MRM), can be used to identify and quantify PTMs on atpF under different conditions.